Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.24
PubTator Score 4.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Facioscapulohumeral muscular dystrophy 26 3.382 1.7

Gene RIF (2)

AA Sequence

MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRR      1 - 70
LQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGIS     71 - 140
QLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEKR                    141 - 194
//

Text Mined References (9)

PMID Year Title