Property Summary

NCBI Gene PubMed Count 63
Grant Count 78
R01 Count 55
Funding $5,813,452.01
PubMed Score 69.43
PubTator Score 55.37

Knowledge Summary

Patent

No data available

Synonym

Accession Q8WWW0 A8K1E6 Q5SY32 Q8WWV9 Q8WXF4 Q9BT99
Symbols RAPL
Maxp1
NORE1
NORE1A
NORE1B
RASSF3

Gene

PANTHER Protein Class (2)

PDB

4LGD   4OH8  

Gene RIF (39)

PMID Text
26986513 mCD40L-induced cell death mediated by NORE1A expression appeared to be independent of mCD40L-induced cell death mediated by sustained JNK activation since NORE1A inhibition did not affect JNK phosphorylation and vice versa
26677227 Ras induces the formation of a complex between NORE1A and the phosphatase PP1A, promoting the activation of the Rb tumor suppressor by dephosphorylation
25778922 NORE1A allows Ras to qualitatively modify p53 function to promote senescence.
25579665 the inactivation of RASSF5A through CpG island 1 methylation may play an important role in esophageal squamous cell carcinoma (ESCC) carcinogenesis, RASSF5A may be a functional tumor suppressor and may serve as a prognostic biomarker for ESCC.
25420558 Down-regulation of RASSF5A and RASSF5C expression is a tumor-specific phenomenon.
25217643 NORE1A has a role in Ras regulation of SCF(beta-TrCP) protein activity and specificity
25109282 RASSF5 expression is negatively correlated with distant metastasis of osteosarcoma, and RASSF5 may function as a tumor suppressor in OS cells through activation of the MST1/LATS1 pathway.
23972470 RASSF5 can act as an inhibitor or a potential positive regulator of Mst2, depending on whether it binds to Mst2 before or after activation-loop phosphorylation.
23538446 Ubiquitin ligase Itch is a unique negative regulator of RASSF5.
22750872 crystal of NORE1 diffracted to 2.7 A resolution and belonged to space group P6(1)22, with unit-cell parameters a = b = 73.041, c = 66.092 A, alpha = beta = 90, gamma = 120 degrees
More...

AA Sequence

MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGRSARRAARGNL      1 - 70
EPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLC     71 - 140
GREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQE    141 - 210
IKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSF    211 - 280
YLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGP    281 - 350
DTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG      351 - 418
//

Text Mined References (68)

PMID Year Title
26986513 2016 NORE1A induction by membrane-bound CD40L (mCD40L) contributes to CD40L-induced cell death and G1 growth arrest in p21-mediated mechanism.
26677227 2016 Ras Regulates Rb via NORE1A.
25778922 2015 NORE1A is a Ras senescence effector that controls the apoptotic/senescent balance of p53 via HIPK2.
25579665 2015 RASSF5A, a candidate tumor suppressor, is epigenetically inactivated in esophageal squamous cell carcinoma.
25420558 2015 Decreased expression and aberrant methylation of RASSF5A correlates with malignant progression of gastric cardia adenocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25217643 2014 Ras regulates SCF(?-TrCP) protein activity and specificity via its effector protein NORE1A.
25109282 2014 RASSF5 inhibits growth and invasion and induces apoptosis in osteosarcoma cells through activation of MST1/LATS1 signaling.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
More...