Property Summary

NCBI Gene PubMed Count 66
PubMed Score 71.34
PubTator Score 55.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Kidney Neoplasms 37 0.0 0.0
Neuroblastoma 80 0.0 0.0
Disease Target Count
Kidney Neoplasm 29
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.191 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia 1.200 2.6e-02
adult high grade glioma 1.100 1.3e-02
atypical teratoid / rhabdoid tumor 1.200 8.2e-03
COPD -1.100 6.4e-03
glioblastoma 1.400 1.5e-02
group 3 medulloblastoma -1.200 4.2e-02
medulloblastoma, large-cell 1.700 1.9e-05
osteosarcoma -2.137 3.2e-03
ovarian cancer 1.700 3.5e-05
pancreatic cancer 1.100 7.5e-03
spina bifida -1.476 3.9e-02
ulcerative colitis 1.200 1.6e-03

Gene RIF (42)

AA Sequence

MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGRSARRAARGNL      1 - 70
EPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLC     71 - 140
GREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQE    141 - 210
IKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSF    211 - 280
YLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGP    281 - 350
DTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG      351 - 418
//

Text Mined References (71)

PMID Year Title