Property Summary

NCBI Gene PubMed Count 27
Grant Count 28
R01 Count 19
Funding $4,463,786.65
PubMed Score 36.34
PubTator Score 18.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.030
malignant mesothelioma 1.500 0.000
psoriasis -2.300 0.000
osteosarcoma -2.439 0.000
group 4 medulloblastoma 1.100 0.000
lung adenocarcinoma 1.200 0.000

Gene RIF (5)

PMID Text
25748791 ATXN2L associates with the protein arginine-N-methyltransferase 1 (PRMT1).
25631074 Cellular biotinylated ataxin 2-like protein is incorporated into HIV-1 Gag virus-like particles
25010285 Cellular biotinylated ataxin 2-like protein is incorporated into HIV-1 Gag virus-like particles
20473688 Observational study of gene-disease association. (HuGE Navigator)
17392519 cellular ataxin-2 concentration is important for the assembly of stress granules and P-bodies, ataxin-2 interacts with the DEAD/H-box RNA helicase DDX6

AA Sequence

MLKPQPLQQPSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR      1 - 70
RGAEGILAPQPPPPQQHQERPGAAAIGSARGQSTGKGPPQSPVFEGVYNNSRMLHFLTAVVGSTCDVKVK     71 - 140
NGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIVDTMVFKPSDVMLVHFRNVDFNYATKDKFTD    141 - 210
SAIAMNSKVNGEHKEKVLQRWEGGDSNSDDYDLESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYTVP    211 - 280
LEKDNSEEFRQRELRAAQLAREIESSPQYRLRIAMENDDGRTEEEKHSAVQRQGSGRESPSLASREGKYI    281 - 350
PLPQRVREGPRGGVRCSSSRGGRPGLSSLPPRGPHHLDNSSPGPGSEARGINGGPSRMSPKAQRPLRGAK    351 - 420
TLSSPSNRPSGETSVPPPPAVGRMYPPRSPKSAAPAPISASCPEPPIGSAVPTSSASIPVTSSVSDPGVG    421 - 490
SISPASPKISLAPTDVKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRFQLEELRKFGAQFKLQPSSSP    491 - 560
ENSLDPFPPRILKEEPKGKEKEVDGLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTEGPEQPPPPCPS    561 - 630
QTGSPPVGLIKGEDKDEGPVAEQVKKSTLNPNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTA    631 - 700
GQSGLYSPQYISYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQA    701 - 770
AAAAGPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTP    771 - 840
QYPSAEQPTPQALYATVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQHQAGQAPHLGSGQPQ    841 - 910
QNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHHQQLPHGFTNMAHVTQAHVQTGITAAPPPHP    911 - 980
GAPHPPQVMLLHPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQAPGFPGGADDRIREFS    981 - 1050
LAGGIWHGRAEGLQVGQDARVLGGE                                                1051 - 1075
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25748791 2015 PRMT1-mediated arginine methylation controls ATXN2L localization.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
23209657 2012 Ataxin-2-like is a regulator of stress granules and processing bodies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...