Property Summary

NCBI Gene PubMed Count 27
PubMed Score 36.34
PubTator Score 18.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Inflammatory Bowel Diseases 87
Disease Target Count P-value
lung adenocarcinoma 2714 4.73185571907594E-11
osteosarcoma 7933 8.52051435243779E-9
malignant mesothelioma 3163 4.16595901767062E-6
psoriasis 6685 4.07064935524846E-5
group 4 medulloblastoma 1875 4.61367816821294E-4
Rheumatoid Arthritis 1171 0.0301419382045785
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Gastrointestinal system disease 50 0.0 2.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 2 19 4.958 2.5
Disease Target Count
Common variable immunodeficiency 98

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.030
malignant mesothelioma 1.500 0.000
psoriasis -2.300 0.000
osteosarcoma -2.439 0.000
group 4 medulloblastoma 1.100 0.000
lung adenocarcinoma 1.200 0.000

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG
Fruitfly OMA Inparanoid

Gene RIF (5)

PMID Text
25748791 ATXN2L associates with the protein arginine-N-methyltransferase 1 (PRMT1).
25631074 Cellular biotinylated ataxin 2-like protein is incorporated into HIV-1 Gag virus-like particles
25010285 Cellular biotinylated ataxin 2-like protein is incorporated into HIV-1 Gag virus-like particles
20473688 Observational study of gene-disease association. (HuGE Navigator)
17392519 cellular ataxin-2 concentration is important for the assembly of stress granules and P-bodies, ataxin-2 interacts with the DEAD/H-box RNA helicase DDX6

AA Sequence

MLKPQPLQQPSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR      1 - 70
RGAEGILAPQPPPPQQHQERPGAAAIGSARGQSTGKGPPQSPVFEGVYNNSRMLHFLTAVVGSTCDVKVK     71 - 140
NGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIVDTMVFKPSDVMLVHFRNVDFNYATKDKFTD    141 - 210
SAIAMNSKVNGEHKEKVLQRWEGGDSNSDDYDLESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYTVP    211 - 280
LEKDNSEEFRQRELRAAQLAREIESSPQYRLRIAMENDDGRTEEEKHSAVQRQGSGRESPSLASREGKYI    281 - 350
PLPQRVREGPRGGVRCSSSRGGRPGLSSLPPRGPHHLDNSSPGPGSEARGINGGPSRMSPKAQRPLRGAK    351 - 420
TLSSPSNRPSGETSVPPPPAVGRMYPPRSPKSAAPAPISASCPEPPIGSAVPTSSASIPVTSSVSDPGVG    421 - 490
SISPASPKISLAPTDVKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRFQLEELRKFGAQFKLQPSSSP    491 - 560
ENSLDPFPPRILKEEPKGKEKEVDGLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTEGPEQPPPPCPS    561 - 630
QTGSPPVGLIKGEDKDEGPVAEQVKKSTLNPNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTA    631 - 700
GQSGLYSPQYISYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQA    701 - 770
AAAAGPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTP    771 - 840
QYPSAEQPTPQALYATVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQHQAGQAPHLGSGQPQ    841 - 910
QNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHHQQLPHGFTNMAHVTQAHVQTGITAAPPPHP    911 - 980
GAPHPPQVMLLHPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQAPGFPGGADDRIREFS    981 - 1050
LAGGIWHGRAEGLQVGQDARVLGGE                                                1051 - 1075
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25748791 2015 PRMT1-mediated arginine methylation controls ATXN2L localization.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
23209657 2012 Ataxin-2-like is a regulator of stress granules and processing bodies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...