Property Summary

NCBI Gene PubMed Count 10
Grant Count 85
R01 Count 49
Funding $12,057,026.58
PubMed Score 581.33
PubTator Score 365.11

Knowledge Summary

Patent

No data available

Synonym

Accession Q8WWH4 A0AV27 A4D0V0 B7ZM20
Symbols ALP1
GASZ
Orf3
ANKL1
C7orf7
CT1.19

Gene

 GO Function (1)

 GO Component (2)

Gene RIF (1)

PMID Text
23816659 Data reveal a potential role of GASZ during embryonic germ cell development and provide a powerful in vitro system for dissecting the molecular pathways in early germ cell formation during embryogenesis.

AA Sequence

MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGI      1 - 70
SVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNA     71 - 140
DPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKML    141 - 210
QTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLE    211 - 280
VFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLE    281 - 350
ISGDEFLNFLLKLNKQCGHLITAVQNVITELPVNSQKITLEWASPQNFTSVCEELVNNVEDLSEKVCKLK    351 - 420
DLIQKLQNERENDPTHIQLREEVSTWNSRILKRTAITICGFGFLLFICKLTFQRK                   421 - 475
//

Text Mined References (10)

PMID Year Title
23966867 2013 Genome-wide association of body fat distribution in African ancestry populations suggests new loci.
23816659 2013 GASZ promotes germ cell derivation from embryonic stem cells.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364959 2004 Transcription-dependent spatial arrangements of CFTR and adjacent genes in human cell nuclei.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12040005 2002 Identification of Gasz, an evolutionarily conserved gene expressed exclusively in germ cells and encoding a protein with four ankyrin repeats, a sterile-alpha motif, and a basic leucine zipper.
11279520 2001 Mutational and functional analyses reveal that ST7 is a highly conserved tumor-suppressor gene on human chromosome 7q31.