Property Summary

NCBI Gene PubMed Count 27
PubMed Score 15.89
PubTator Score 13.66

Knowledge Summary

Patent (1,402)

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.400 1.2e-03
Astrocytoma, Pilocytic 1.300 3.1e-03
Breast cancer 1.800 7.4e-03
breast carcinoma 1.100 4.6e-09
cystic fibrosis -3.396 6.5e-08
ependymoma 1.300 4.7e-05
glioblastoma 1.200 4.7e-03
intraductal papillary-mucinous adenoma (... -1.700 3.1e-03
intraductal papillary-mucinous carcinoma... -1.800 4.7e-03
intraductal papillary-mucinous neoplasm ... -2.800 1.2e-03
lung adenocarcinoma 1.100 8.4e-06
lung cancer 1.300 1.8e-02
lung carcinoma 2.500 1.6e-14
malignant mesothelioma -3.500 1.4e-07
medulloblastoma, large-cell 1.100 2.7e-04
osteosarcoma 2.663 1.3e-03
ovarian cancer 1.600 4.7e-03
psoriasis -1.100 2.0e-02
subependymal giant cell astrocytoma 3.104 7.9e-04

Gene RIF (16)

AA Sequence

MHFLTIYPNCSSGVVRAQSRTEQKNPLGLDDLGIQNLGQTVSLAPAVEAASMLKMEPLNSTHPGTAASSS      1 - 70
PLESRAAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKSKRREKKSSLLLLYKDEERLWGEAMKPLPV     71 - 140
VSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSESSSPDVHLTIQEEGADDELEETSETPLNESS    141 - 210
EGSSENIHQNS                                                               211 - 221
//

Text Mined References (28)

PMID Year Title