Property Summary

NCBI Gene PubMed Count 25
Grant Count 29
R01 Count 19
Funding $2,264,606.4
PubMed Score 15.20
PubTator Score 13.66

Knowledge Summary

Patent (1,402)

Expression

Gene RIF (14)

PMID Text
23866632 the association of the KCNE4 gene variability with allergic rhinitis
21118809 KCNE4 juxtamembrane region is required for interaction with calmodulin and for functional suppression of KCNQ1.
20498229 MiRP3 modulates Kv4.2 current activation, inactivation and recovery from inactivation. MiRP3 shifts the half-maximal voltage for activation and slows time to peak ~ 100%.
19773357 KCNE4 (potassium voltage-gated channel subfamily E member 4), but not KCNE2, functions as an inhibitory Kv1.3 partner in leukocytes.
19029186 Specific KCNE4 domains responsible for the inhibitory effects on heterologously expressed KCNQ1 were identified. The KCNE4 C-terminus is critical for KCNQ1 modulation and physically interacts with KCNQ1.
18463315 MiRP3 (encoded by the KCNE4 gene) plays a role in modulation of BK-dependent urinary potassium excretion.
18279388 KCNE4 directly associates with KCNQ1, and can co-associate together with KCNE1 in the same KCNQ1 complex to form a 'triple subunit' complex (KCNE1-KCNQ1-KCNE4).
17016049 Observational study of gene-disease association. (HuGE Navigator)
17016049 The non-synonymous single nucleotide polymorphism E145D may be associated with the atrial fibrillation phenotype.
16563243 KCNE4 E145D polymorphism may be related to atrial fibrillation.
More...

AA Sequence

MHFLTIYPNCSSGVVRAQSRTEQKNPLGLDDLGIQNLGQTVSLAPAVEAASMLKMEPLNSTHPGTAASSS      1 - 70
PLESRAAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKSKRREKKSSLLLLYKDEERLWGEAMKPLPV     71 - 140
VSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSESSSPDVHLTIQEEGADDELEETSETPLNESS    141 - 210
EGSSENIHQNS                                                               211 - 221
//

Text Mined References (26)

PMID Year Title
23866632 2013 [Effect of additional disease (comorbidity) on association of allergic rhinitis with KCNE4 gene rs12621643 variant].
21118809 2011 KCNE4 juxtamembrane region is required for interaction with calmodulin and for functional suppression of KCNQ1.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20533308 2010 Impact of KCNE subunits on KCNQ1 (Kv7.1) channel membrane surface targeting.
20498229 2010 The membrane protein MiRP3 regulates Kv4.2 channels in a KChIP-dependent manner.
19773357 2009 KCNE4 suppresses Kv1.3 currents by modulating trafficking, surface expression and channel gating.
19687231 2009 Distinct subdomains of the KCNQ1 S6 segment determine channel modulation by different KCNE subunits.
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
19029186 2009 KCNE4 domains required for inhibition of KCNQ1.
18463315 2008 MiRP3 acts as an accessory subunit with the BK potassium channel.
More...