Property Summary

NCBI Gene PubMed Count 25
PubMed Score 15.20
PubTator Score 13.66

Knowledge Summary

Patent (1,402)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.60382503758409E-14
breast carcinoma 1614 5.64433484276724E-12
posterior fossa group A ependymoma 1511 4.07783322699765E-8
malignant mesothelioma 3163 1.445521034029E-7
cystic fibrosis 1670 2.63632319867102E-7
lung adenocarcinoma 2714 8.35100573602706E-6
ovarian cancer 8492 1.77267890226676E-4
medulloblastoma, large-cell 6234 4.33535881704277E-4
pilocytic astrocytoma 3086 6.18681712307939E-4
pediatric high grade glioma 2712 7.02478900000159E-4
subependymal giant cell astrocytoma 2287 7.8536732235606E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00121461092671253
osteosarcoma 7933 0.0012696483132553
lung cancer 4473 0.00221000919045012
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00455796841248895
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00473024400441442
glioblastoma 5572 0.00510922959015982
Breast cancer 3099 0.0126389711321852
psoriasis 6685 0.0204564313094937
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Lymphoid leukemia 69 0.0 1.0

Expression

Synonym

Accession Q8WWG9 B7Z275 Q53SM4 Q96CC4
Symbols MIRP3

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (14)

PMID Text
23866632 the association of the KCNE4 gene variability with allergic rhinitis
21118809 KCNE4 juxtamembrane region is required for interaction with calmodulin and for functional suppression of KCNQ1.
20498229 MiRP3 modulates Kv4.2 current activation, inactivation and recovery from inactivation. MiRP3 shifts the half-maximal voltage for activation and slows time to peak ~ 100%.
19773357 KCNE4 (potassium voltage-gated channel subfamily E member 4), but not KCNE2, functions as an inhibitory Kv1.3 partner in leukocytes.
19029186 Specific KCNE4 domains responsible for the inhibitory effects on heterologously expressed KCNQ1 were identified. The KCNE4 C-terminus is critical for KCNQ1 modulation and physically interacts with KCNQ1.
18463315 MiRP3 (encoded by the KCNE4 gene) plays a role in modulation of BK-dependent urinary potassium excretion.
18279388 KCNE4 directly associates with KCNQ1, and can co-associate together with KCNE1 in the same KCNQ1 complex to form a 'triple subunit' complex (KCNE1-KCNQ1-KCNE4).
17016049 Observational study of gene-disease association. (HuGE Navigator)
17016049 The non-synonymous single nucleotide polymorphism E145D may be associated with the atrial fibrillation phenotype.
16563243 KCNE4 E145D polymorphism may be related to atrial fibrillation.
More...

AA Sequence

MHFLTIYPNCSSGVVRAQSRTEQKNPLGLDDLGIQNLGQTVSLAPAVEAASMLKMEPLNSTHPGTAASSS      1 - 70
PLESRAAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKSKRREKKSSLLLLYKDEERLWGEAMKPLPV     71 - 140
VSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSESSSPDVHLTIQEEGADDELEETSETPLNESS    141 - 210
EGSSENIHQNS                                                               211 - 221
//

Text Mined References (26)

PMID Year Title
23866632 2013 [Effect of additional disease (comorbidity) on association of allergic rhinitis with KCNE4 gene rs12621643 variant].
21118809 2011 KCNE4 juxtamembrane region is required for interaction with calmodulin and for functional suppression of KCNQ1.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20533308 2010 Impact of KCNE subunits on KCNQ1 (Kv7.1) channel membrane surface targeting.
20498229 2010 The membrane protein MiRP3 regulates Kv4.2 channels in a KChIP-dependent manner.
19773357 2009 KCNE4 suppresses Kv1.3 currents by modulating trafficking, surface expression and channel gating.
19687231 2009 Distinct subdomains of the KCNQ1 S6 segment determine channel modulation by different KCNE subunits.
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
19029186 2009 KCNE4 domains required for inhibition of KCNQ1.
18463315 2008 MiRP3 acts as an accessory subunit with the BK potassium channel.
More...