Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Substance-Related Disorders 115 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.1e-28

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 2.1e-28

Gene RIF (1)

AA Sequence

MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVN      1 - 70
SEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEI     71 - 140
TERAKKAHLKPYEEIYGVSSTKTSAPSPKVLQHEELLPKYPDFSIPDGSCPALGRPLREDPKTPLTCGCA    141 - 210
QRPSIPCSGKMYLEPLSSAK                                                      211 - 230
//

Text Mined References (6)

PMID Year Title