Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Substance-Related Disorders 114
Disease Target Count P-value
psoriasis 6685 2.1463856697941E-28

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

Gene RIF (1)

PMID Text
18976975 Knockdown of chromosome 10 open reading frame 82 (C10orf82) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVN      1 - 70
SEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEI     71 - 140
TERAKKAHLKPYEEIYGVSSTKTSAPSPKVLQHEELLPKYPDFSIPDGSCPALGRPLREDPKTPLTCGCA    141 - 210
QRPSIPCSGKMYLEPLSSAK                                                      211 - 230
//

Text Mined References (6)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.