Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.41
PubTator Score 1.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (1)

AA Sequence

MTLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWAFPVITGSLFV      1 - 70
LTFFSLVSLNFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFHRPPRTYHCPWCNICVEDFDH     71 - 140
HCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLVRTTHLPFSTDKAIAIVVAVSAAGLLVPLSL    141 - 210
LLLIQALSVSSADRTYKGKCRHLQGYNPFDQGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNL    211 - 280
HPPMSPSALNPPAPTSGSLQSREGTPGAW                                             281 - 309
//

Text Mined References (8)

PMID Year Title