Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.41
PubTator Score 1.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WVZ1 A8MSY6 B3KVI1
Symbols DHHC19

Gene

Gene RIF (1)

PMID Text
20074548 The increased palmitoylation of R-Ras cotransfected with DHHC19 is accompanied by an augmented association with membranes as well as with rafts/caveolae.

AA Sequence

MTLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWAFPVITGSLFV      1 - 70
LTFFSLVSLNFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFHRPPRTYHCPWCNICVEDFDH     71 - 140
HCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLVRTTHLPFSTDKAIAIVVAVSAAGLLVPLSL    141 - 210
LLLIQALSVSSADRTYKGKCRHLQGYNPFDQGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNL    211 - 280
HPPMSPSALNPPAPTSGSLQSREGTPGAW                                             281 - 309
//

Publication (8)

PMID Year Title
21160409 2011 Common human genetic variants and HIV-1 susceptibility: a genome-wide survey in a homogeneous African population.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20074548 2010 Palmitoylation of R-Ras by human DHHC19, a palmitoyl transferase with a CaaX box.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.