Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.45
PubTator Score 14.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (7)

PMID Text
23831407 Data revealed novel aspects of the interplay between autophagy and apoptosis in nasopharyngeal carcinoma cells, which underlies the tumor suppression function of NOR1.
21803736 Frequent epigenetic inactivation of the NOR1 gene in nasopharyngeal carcinoma (NPC) suggests that it may be a critical tumor suppressor involved in the development of nasopharyngeal carcinoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19727524 NOR1 protein is predominantly expressed in human nasopharynx and tracheal tissues and is frequently down-expressed in NPC.
18237537 NOR(1) gene may have some effects on liver cancer by up-regulating the expression of these proteins.
16006562 hOSCP1 is a novel polyspecific organic solute carrier protein responsible for drug clearance from the human placenta
12819961 We cloned a novel gene NOR(1), and the Glu58Gly polymorphism of NOR(1) may be involved in the development and/or progression of NPC suggesting that NOR(1) could be a candidate tumor repressor gene related with NPC.

AA Sequence

MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLNDIISTMFNRKFMEELFKPQE      1 - 70
LYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSP     71 - 140
TILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGT    141 - 210
EVPGLIRMFNNKGEEVKRIEFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLAS    211 - 280
WTQESIAPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRPEELSYEVINIQAT    281 - 350
QDQQRSEELARIMGEFEITEQPRLSTSKGDDLLAMMDEL                                   351 - 389
//

Text Mined References (16)

PMID Year Title
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23831407 2013 Tumor suppressor gene Oxidored-nitro domain-containing protein 1 regulates nasopharyngeal cancer cell autophagy, metabolism, and apoptosis in vitro.
21803736 2011 NOR1 is an HSF1- and NRF1-regulated putative tumor suppressor inactivated by promoter hypermethylation in nasopharyngeal carcinoma.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19727524 2009 Preparation of polyclonal antibody specific for NOR1 and detection of its expression pattern in human tissues and nasopharyngeal carcinoma.
18237537 2008 [Effects of a novel gene NOR(1) on the protein expression of HepG2 cell line].
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16006562 2005 Isolation and functional characterization of a novel organic solute carrier protein, hOSCP1.
More...