Property Summary

NCBI Gene PubMed Count 24
Grant Count 17
R01 Count 3
Funding $1,541,098.01
PubMed Score 108.22
PubTator Score 30.51

Knowledge Summary

Patent

No data available

Expression

 MGI Term (1)

Protein-protein Interaction (11)

Gene RIF (3)

PMID Text
24686170 PRL-3 and Leo1 levels were positively associated in AML patient samples.
24038468 The results show that the Paf1/Leo1 heterodimer is necessary for its binding to histone H3, the histone octamer, and nucleosome in vitro.
20196086 Screened glioblastomas and oligodendrogliomas for fusion genes by identifying aberrant 5'-3' expression of genes that lie over regions of a copy number change. A fusion gene between exon 11 of LEO1 and exon 10 of SLC12A1 was identified.

AA Sequence

MADMEDLFGSDADSEAERKDSDSGSDSDSDQENAASGSNASGSESDQDERGDSGQPSNKELFGDDSEDEG      1 - 70
ASHHSGSDNHSERSDNRSEASERSDHEDNDPSDVDQHSGSEAPNDDEDEGHRSDGGSHHSEAEGSEKAHS     71 - 140
DDEKWGREDKSDQSDDEKIQNSDDEERAQGSDEDKLQNSDDDEKMQNTDDEERPQLSDDERQQLSEEEKA    141 - 210
NSDDERPVASDNDDEKQNSDDEEQPQLSDEEKMQNSDDERPQASDEEHRHSDDEEEQDHKSESARGSDSE    211 - 280
DEVLRMKRKNAIASDSEADSDTEVPKDNSGTMDLFGGADDISSGSDGEDKPPTPGQPVDENGLPQDQQEE    281 - 350
EPIPETRIEVEIPKVNTDLGNDLYFVKLPNFLSVEPRPFDPQYYEDEFEDEEMLDEEGRTRLKLKVENTI    351 - 420
RWRIRRDEEGNEIKESNARIVKWSDGSMSLHLGNEVFDVYKAPLQGDHNHLFIRQGTGLQGQAVFKTKLT    421 - 490
FRPHSTDSATHRKMTLSLADRCSKTQKIRILPMAGRDPECQRTEMIKKEEERLRASIRRESQQRRMREKQ    491 - 560
HQRGLSASYLEPDRYDEEEEGEESISLAAIKNRYKGGIREERARIYSSDSDEGSEEDKAQRLLKAKKLTS    561 - 630
DEEGEPSGKRKAEDDDKANKKHKKYVISDEEEEDDD                                      631 - 666
//

Publication (35)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24686170 2014 LEO1 is regulated by PRL-3 and mediates its oncogenic properties in acute myelogenous leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24038468 2013 Structural insights into Paf1 complex assembly and histone binding.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21329879 2011 Transcriptional activators enhance polyadenylation of mRNA precursors.
21269460 2011 Initial characterization of the human central proteome.
More...