Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 0.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.384 6.4e-04
adult high grade glioma 1.100 1.1e-02
aldosterone-producing adenoma -1.343 1.6e-02
Astrocytoma, Pilocytic 1.600 1.7e-05
atypical teratoid / rhabdoid tumor 1.500 5.8e-03
ependymoma 1.600 1.2e-08
glioblastoma 1.200 1.5e-04
hereditary spastic paraplegia -1.042 2.8e-02
invasive ductal carcinoma 1.100 1.2e-02
juvenile dermatomyositis 1.483 2.7e-09
lung cancer 1.900 1.3e-05
medulloblastoma, large-cell -1.100 2.4e-03
osteosarcoma 1.410 4.7e-03
ovarian cancer -1.100 1.1e-02
subependymal giant cell astrocytoma 2.108 8.7e-03
tuberculosis -1.900 1.2e-05

AA Sequence

MVPPRRHRGAGRPGVLSSSPPFRLRSAKFSGIALEDLRRALKTRLQMVCVFVMNRMNSQNSGFTQRRRMA      1 - 70
LGIVILLLVDVIWVASSELTSYVFTQYNKPFFSTFAKTSMFVLYLLGFIIWKPWRQQCTRGLRGKHAAFF     71 - 140
ADAEGYFAACTTDTTMNSSLSEPLYVPVKFHDLPSEKPESTNIDTEKTPKKSRVRFSNIMEIRQLPSSHA    141 - 210
LEAKLSRMSYPVKEQESILKTVGKLTATQVAKISFFFCFVWFLANLSYQEALSDTQVAIVNILSSTSGLF    211 - 280
TLILAAVFPSNSGDRFTLSKLLAVILSIGGVVLVNLAGSEKPAGRDTVGSIWSLAGAMLYAVYIVMIKRK    281 - 350
VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCIIINGLIGTVLSEFLWLWGCF    351 - 420
LTSSLIGTLALSLTIPLSIIADMCMQKVQFSWLFFAGAIPVFFSFFIVTLLCHYNNWDPVMVGIRRIFAF    421 - 490
ICRKHRIQRVPEDSEQCESLISMHSVSQEDGAS                                         491 - 523
//

Text Mined References (7)

PMID Year Title