Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.25
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 0.0
Disease Target Count P-value
group 4 medulloblastoma 1855 4.2e-06
lung cancer 4740 2.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.200 4.2e-06
lung cancer 1.300 2.6e-04

Gene RIF (3)

AA Sequence

MLCDEKAQKRRKRKAKESGMALPQGHLTFRDVAIEFSQAEWKCLDPAQRALYKDVMLENYRNLVSLGISL      1 - 70
PDLNINSMLEQRREPWSGESEVKIAKNSDGRECIKGVNTGSSYALGSNAEDKPIKKQLGVSFHLHLSELE     71 - 140
LFPDERVINGCNQVENFINHSSSVSCLQEMSSSVKTPIFNRNDFDDSSFLPQEQKVHLREKPYECNEHSK    141 - 210
VFRVSSSLTKHQVIHTVEKPYKCNSCGKVFSRNSHLAEHCRIHTGEKPYKCNVCGKVFSYNSNFARHQRI    211 - 280
HTREKPYECNECGKVFSNNSYLARHQRIHAEEKPYKCNECGKGFSHKSSLANHWRIYTGEKPYKCDECGK    281 - 350
AFYRIALLVRHQKIHTGEKPYKCNECGKVFIQNSHLAQHWRIHTGEKPYKCNECGKVFNQLSNLARHRRI    351 - 420
HTGEKPYKCNECGKAFSEYSGLSAHLVIHTGEKPYKCSECGKAFRHKLSLTNHQRIHTGERPYKCNECGK    421 - 490
VFNRIAHLARHRKIHTGEKPYKCNECGKAFSRISYLAQHWTIHMG                             491 - 535
//

Text Mined References (11)

PMID Year Title