| Tdark | Non-structural maintenance of chromosomes element 1 homolog |
Component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Has in vitro ubiquitin ligase activity in presence of NSMCE3. Is involved in positive regulation of response to DNA damage stimulus.
Comments
| Accession | Q8WV22 D3DWF6 Q9P045 Q9P049 Non-SMC element 1 homolog |
| Symbols |
NSE1 |
| Species | Source |
|---|---|
| Chimp | OMA EggNOG |
| Mouse | OMA EggNOG Inparanoid |
| Rat | OMA EggNOG Inparanoid |
| Dog | OMA EggNOG Inparanoid |
| Cow | OMA EggNOG Inparanoid |
| Opossum | OMA EggNOG Inparanoid |
| Platypus | OMA EggNOG Inparanoid |
| Chicken | OMA EggNOG Inparanoid |
| Anole lizard | OMA EggNOG Inparanoid |
| Xenopus | OMA EggNOG Inparanoid |
| Fruitfly | EggNOG Inparanoid |
MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIE 1 - 70 IKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNILNLVDQLKGKK 71 - 140 MRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIR 141 - 210 MHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNKKSLRSRQH 211 - 266 //
| PMID | Year | Title |
|---|---|---|
| 26496610 | 2015 | A human interactome in three quantitative dimensions organized by stoichiometries and abundances. |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
| 21364888 | 2011 | Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. |
| 21269460 | 2011 | Initial characterization of the human central proteome. |
| 20864041 | 2010 | MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases. |
| 18086888 | 2008 | Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex. |
| 15616553 | 2004 | The sequence and analysis of duplication-rich human chromosome 16. |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
| 14701739 | 2004 | Coordination of DNA damage responses via the Smc5/Smc6 complex. |
| More... |
