Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.90
PubTator Score 1.50

Knowledge Summary


No data available


Accession Q8WUU8 B2RDA0 Q96N81


Gene RIF (1)

20331980 these results suggest the potential role of TMEM174 in renal development and physiological function.

AA Sequence

NPDVDQLEETQLEEEACACFSPPPYEEIYSLPR                                         211 - 243

Publication (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
20331980 2010 Human TMEM174 that is highly expressed in kidney tissue activates AP-1 and promotes cell proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.