Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.90
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MEQGSGRLEDFPVNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWIKYQGVSHFEW      1 - 70
TQLLGPVLLSVGVTFILIAVCKFKMLSCQLCKESEERVPDSEQTPGGPSFVFTGINQPITFHGATVVQYI     71 - 140
PPPYGSPEPMGINTSYLQSVVSPCGLITSGGAAAAMSSPPQYYTIYPQDNSAFVVDEGCLSFTDGGNHRP    141 - 210
NPDVDQLEETQLEEEACACFSPPPYEEIYSLPR                                         211 - 243
//

Text Mined References (6)

PMID Year Title