Property Summary

NCBI Gene PubMed Count 19
PubMed Score 9.10
PubTator Score 2.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 2.3e-07
psoriasis 6694 5.6e-04
osteosarcoma 7950 7.6e-04
acute myeloid leukemia 783 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 0.0 0.9
Disease Target Count Z-score Confidence
ARC syndrome 13 4.15 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 1.100 4.4e-02
osteosarcoma 1.278 7.6e-04
ovarian cancer -1.300 2.3e-07
psoriasis 1.200 5.6e-04

Gene RIF (6)

AA Sequence

MMSIKAFTLVSAVERELLMGDKERVNIECVECCGRDLYVGTNDCFVYHFLLEERPVPAGPATFTATKQLQ      1 - 70
RHLGFKKPVNELRAASALNRLLVLCDNSISLVNMLNLEPVPSGARIKGAATFALNENPVSGDPFCVEVCI     71 - 140
ISVKRRTIQMFLVYEDRVQIVKEVSTAEQPLAVAVDGHFLCLALTTQYIIHNYSTGVSQDLFPYCSEERP    141 - 210
PIVKRIGRQEFLLAGPGGLGMFATVAGISQRAPVHWSENVIGAAVSFPYVIALDDEFITVHSMLDQQQKQ    211 - 280
TLPFKEGHILQDFEGRVIVATSKGVYILVPLPLEKQIQDLLASRRVEEALVLAKGARRNIPKEKFQVMYR    281 - 350
RILQQAGFIQFAQLQFLEAKELFRSGQLDVRELISLYPFLLPTSSSFTRSHPPLHEYADLNQLTQGDQEK    351 - 420
MAKCKRFLMSYLNEVRSTEVANGYKEDIDTALLKLYAEADHDSLLDLLVTENFCLLTDSAAWLEKHKKYF    421 - 490
ALGLLYHYNNQDAAAVQLWVNIVNGDVQDSTRSDLYEYIVDFLTYCLDEELVWAYADWVLQKSEEVGVQV    491 - 560
FTKRPLDEQQKNSFNPDDIINCLKKYPKALVKYLEHLVIDKRLQKEEYHTHLAVLYLEEVLLQRASASGK    561 - 630
GAEATETQAKLRRLLQKSDLYRVHFLLERLQGAGLPMESAILHGKLGEHEKALHILVHELQDFAAAEDYC    631 - 700
LWCSEGRDPPHRQQLFHTLLAIYLHAGPTAHELAVAAVDLLNRHATEFDAAQVLQMLPDTWSVQLLCPFL    701 - 770
MGAMRDSIHARRTMQVALGLARSENLIYTYDKMKLKGSSIQLSDKKLCQICQNPFCEPVFVRYPNGGLVH    771 - 840
THCAASRHTNPSSSSPGTRT                                                      841 - 860
//

Text Mined References (22)

PMID Year Title