Property Summary

NCBI Gene PubMed Count 18
Grant Count 2
R01 Count 2
Funding $216,113.33
PubMed Score 8.90
PubTator Score 2.57

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 0.001
osteosarcoma -1.570 0.000
acute myeloid leukemia 1.100 0.044
ovarian cancer 1.400 0.000

Synonym

Accession Q8WUH2 A8K5R7 D3DVJ8 O60466 TGF-beta receptor-associated protein 1
Symbols VPS3
TRAP1
TRAP-1

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
25856002 the association of rs2679860 polymorphisms of TGFBRAP1 and DBP variation as well as plasma levels of TGF-beta1
21998450 In the absence of Langerhans cells (LC), contact hypersensitivity (CHS) reactions in langerin-positive dendritic cell-specific TGF-betaR1-deficient mice are diminished, providing further evidence against a regulatory role for LC in CHS.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19754311 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16886895 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MMSIKAFTLVSAVERELLMGDKERVNIECVECCGRDLYVGTNDCFVYHFLLEERPVPAGPATFTATKQLQ      1 - 70
RHLGFKKPVNELRAASALNRLLVLCDNSISLVNMLNLEPVPSGARIKGAATFALNENPVSGDPFCVEVCI     71 - 140
ISVKRRTIQMFLVYEDRVQIVKEVSTAEQPLAVAVDGHFLCLALTTQYIIHNYSTGVSQDLFPYCSEERP    141 - 210
PIVKRIGRQEFLLAGPGGLGMFATVAGISQRAPVHWSENVIGAAVSFPYVIALDDEFITVHSMLDQQQKQ    211 - 280
TLPFKEGHILQDFEGRVIVATSKGVYILVPLPLEKQIQDLLASRRVEEALVLAKGARRNIPKEKFQVMYR    281 - 350
RILQQAGFIQFAQLQFLEAKELFRSGQLDVRELISLYPFLLPTSSSFTRSHPPLHEYADLNQLTQGDQEK    351 - 420
MAKCKRFLMSYLNEVRSTEVANGYKEDIDTALLKLYAEADHDSLLDLLVTENFCLLTDSAAWLEKHKKYF    421 - 490
ALGLLYHYNNQDAAAVQLWVNIVNGDVQDSTRSDLYEYIVDFLTYCLDEELVWAYADWVLQKSEEVGVQV    491 - 560
FTKRPLDEQQKNSFNPDDIINCLKKYPKALVKYLEHLVIDKRLQKEEYHTHLAVLYLEEVLLQRASASGK    561 - 630
GAEATETQAKLRRLLQKSDLYRVHFLLERLQGAGLPMESAILHGKLGEHEKALHILVHELQDFAAAEDYC    631 - 700
LWCSEGRDPPHRQQLFHTLLAIYLHAGPTAHELAVAAVDLLNRHATEFDAAQVLQMLPDTWSVQLLCPFL    701 - 770
MGAMRDSIHARRTMQVALGLARSENLIYTYDKMKLKGSSIQLSDKKLCQICQNPFCEPVFVRYPNGGLVH    771 - 840
THCAASRHTNPSSSSPGTRT                                                      841 - 860
//

Text Mined References (21)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26463206 2015 Characterization of the Mammalian CORVET and HOPS Complexes and Their Modular Restructuring for Endosome Specificity.
25856002 2015 Polymorphisms of the TGFBRAP1 gene in relation to blood pressure variability and plasma TGF-?1.
25750764 The Vps39-like TRAP1 is an effector of Rab5 and likely the missing Vps3 subunit of human CORVET.
25266290 2014 Mammalian CORVET is required for fusion and conversion of distinct early endosome subpopulations.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21998450 2011 Conditional deletion of TGF-?R1 using Langerin-Cre mice results in Langerhans cell deficiency and reduced contact hypersensitivity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...