Property Summary

NCBI Gene PubMed Count 7
PubMed Score 183.58
PubTator Score 73.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.700 1.4e-02
cystic fibrosis -1.494 2.6e-06
ependymoma 1.100 9.2e-07
invasive ductal carcinoma -1.100 6.0e-03
ovarian cancer -1.700 1.9e-08
Pick disease 1.500 1.5e-04
subependymal giant cell astrocytoma 1.632 6.6e-03

Gene RIF (2)

AA Sequence

MRQPYLSSREVSSSRKRWRTFPVDCVAMCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITN      1 - 70
KSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF      71 - 139
//

Text Mined References (8)

PMID Year Title