Property Summary

NCBI Gene PubMed Count 7
Grant Count 1
Funding $4,502
PubMed Score 174.19
PubTator Score 73.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 1.500 0.000
cystic fibrosis 1.600 0.000
acute myeloid leukemia -1.700 0.014
subependymal giant cell astrocytoma 1.632 0.007
Pick disease 1.500 0.000
invasive ductal carcinoma -1.300 0.038
ovarian cancer -1.700 0.000

Gene RIF (2)

PMID Text
21360829 This is the first implication of chr14q23.2-23.3 in the etiology of autism and points to MTHFD1, PLEKHG3, and CHURC1 as potential candidate genes contributing to autism risk.
17610897 Embryonic neural inducing factor churchill is not a DNA-binding zinc finger protein: solution structure reveals a solvent-exposed beta-sheet and zinc binuclear cluster

AA Sequence

MRQPYLSSREVSSSRKRWRTFPVDCVAMCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITN      1 - 70
KSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF      71 - 139
//

Text Mined References (8)

PMID Year Title
21360829 2011 A de novo 1.5?Mb microdeletion on chromosome 14q23.2-23.3 in a patient with autism and spherocytosis.
17610897 2007 Embryonic neural inducing factor churchill is not a DNA-binding zinc finger protein: solution structure reveals a solvent-exposed beta-sheet and zinc binuclear cluster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14651851 2003 Churchill, a zinc finger transcriptional activator, regulates the transition between gastrulation and neurulation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.