Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.54
PubTator Score 13.47

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

AA Sequence

MASDPIFTLAPPLHCHYGAFPPNASGWEQPPNASGVSVASAALAASAASRVATSTDPSCSGFAPPDFNHC      1 - 70
LKDWDYNGLPVLTTNAIGQWDLVCDLGWQVILEQILFILGFASGYLFLGYPADRFGRRGIVLLTLGLVGP     71 - 140
CGVGGAAAGSSTGVMALRFLLGFLLAGVDLGVYLMRLELCDPTQRLRVALAGELVGVGGHFLFLGLALVS    141 - 210
KDWRFLQRMITAPCILFLFYGWPGLFLESARWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQD    211 - 280
LENTCPLPATSSFSFASLLNYRNIWKNLLILGFTNFIAHAIRHCYQPVGGGGSPSDFYLCSLLASGTAAL    281 - 350
ACVFLGVTVDRFGRRGILLLSMTLTGIASLVLLGLWDCEHPIFPTVWAQQGNPNRDLNEAAITTFSVLGL    351 - 420
FSSQAAAILSTLLAAEVIPTTVRGRGLGLIMALGALGGLSGPAQRLHMGHGAFLQHVVLAACALLCILSI    421 - 490
MLLPETKRKLLPEVLRDGELCRRPSLLRQPPPTRCDHVPLLATPNPAL                          491 - 538
//

Text Mined References (16)

PMID Year Title