Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
R01 Count 5
Funding $181,093.59
PubMed Score 14.92
PubTator Score 13.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WUG5 A4UA13 A8MUT0 Q2TAB0 Q5BKY8 Q86U04 Q9H1D3 Q9NQD5
Symbols BOCT
BOIT
24p3R
NGALR
hBOIT
NGALR2
NGALR3

Gene

Gene RIF (9)

PMID Text
26635366 Biochemical and Structural Characterization of the Interaction between the Siderocalin NGAL/LCN2 (Neutrophil Gelatinase-associated Lipocalin/Lipocalin 2) and the N-terminal Domain of Its Endocytic Receptor SLC22A17.
26230641 Two novel variants in SLC22A17 and SLC22A7 were significantly associated with anthracycline-induced cardiotoxicity.
24452457 Lipocalin 2 might restore the health and regeneration potential of MSCs by decreasing senescence
22932106 No significant difference was found in the expressions of NGALR mRNA in placenta among moderate preeclampsia group, severe preeclampsia group and control group.
22728279 NGAL and NGALR expression might be served as novel prognostic factors and potential therapeutic targets in Hepatocellular carcinoma.
21763306 These results suggested that SLC22A17, in cooperation with LCN2, to be involved in the acquisition of aggressive behavior among endometrial carcinoma cells.
21305251 Neutrophil gelatinase-associated lipocalin receptor (NGALR) is differentially expressed in human glomerular disease and is significantly up-regulated by Il-1beta in HMC via MAPK/ERK activation.
21184133 This study suggested that NGAL and NGALR expression are frequently up-regulated in gliomas, and are closely associated with poor clinical outcome.
19047093 NGALR hypomethylation contributes to its expression in esophageal carcinomas and that this overexpression may play a role in the pathogenesis of esophageal carcinomas.

AA Sequence

MASDPIFTLAPPLHCHYGAFPPNASGWEQPPNASGVSVASAALAASAASRVATSTDPSCSGFAPPDFNHC      1 - 70
LKDWDYNGLPVLTTNAIGQWDLVCDLGWQVILEQILFILGFASGYLFLGYPADRFGRRGIVLLTLGLVGP     71 - 140
CGVGGAAAGSSTGVMALRFLLGFLLAGVDLGVYLMRLELCDPTQRLRVALAGELVGVGGHFLFLGLALVS    141 - 210
KDWRFLQRMITAPCILFLFYGWPGLFLESARWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQD    211 - 280
LENTCPLPATSSFSFASLLNYRNIWKNLLILGFTNFIAHAIRHCYQPVGGGGSPSDFYLCSLLASGTAAL    281 - 350
ACVFLGVTVDRFGRRGILLLSMTLTGIASLVLLGLWDCEHPIFPTVWAQQGNPNRDLNEAAITTFSVLGL    351 - 420
FSSQAAAILSTLLAAEVIPTTVRGRGLGLIMALGALGGLSGPAQRLHMGHGAFLQHVVLAACALLCILSI    421 - 490
MLLPETKRKLLPEVLRDGELCRRPSLLRQPPPTRCDHVPLLATPNPAL                          491 - 538
//

Text Mined References (16)

PMID Year Title
26635366 2016 Biochemical and Structural Characterization of the Interaction between the Siderocalin NGAL/LCN2 (Neutrophil Gelatinase-associated Lipocalin/Lipocalin 2) and the N-terminal Domain of Its Endocytic Receptor SLC22A17.
26230641 2015 Genetic variants in SLC22A17 and SLC22A7 are associated with anthracycline-induced cardiotoxicity in children.
24452457 2014 Lipocalin 2 decreases senescence of bone marrow-derived mesenchymal stem cells under sub-lethal doses of oxidative stress.
22932106 2012 [Correlation of lipocalin-2 and its receptor expressions with preeclampsia].
22728279 2012 NGAL and NGALR overexpression in human hepatocellular carcinoma toward a molecular prognostic classification.
21763306 2011 Immunohistochemical detection of a specific receptor for lipocalin2 (solute carrier family 22 member 17, SLC22A17) and its prognostic significance in endometrial carcinoma.
21305251 2011 Increased expression of neutrophil gelatinase-associated lipocalin receptor by interleukin-1? in human mesangial cells via MAPK/ERK activation.
21184133 2011 NGAL and NGALR are frequently overexpressed in human gliomas and are associated with clinical prognosis.
19229297 2009 Transcription and signalling pathways involved in BCR-ABL-mediated misregulation of 24p3 and 24p3R.
19047093 2008 NGALR is overexpressed and regulated by hypomethylation in esophageal squamous cell carcinoma.
More...