Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.51
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPL      1 - 70
KVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVS     71 - 140
EDFVPYKGDLLEVEYSTEPGISNIKATSVKPIRCIHTEEVCITSVHGRNGVIDYTIFFTLDSVKLPDGYV    141 - 210
PQVDDIVNVVMVESIQFCFIWRAISITPVHKSSSGFQDDGGLGRPKRERRSQSI                    211 - 264
//

Text Mined References (8)

PMID Year Title