Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.86
PubTator Score 5.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVS      1 - 70
DVEVQEHYDSFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAV     71 - 140
HGELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISQNLQRQLYGRGPRRRSPPRFHTGHHPRERNHR    141 - 210
CSPDHWHGRF                                                                211 - 220
//

Text Mined References (14)

PMID Year Title