Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.86
PubTator Score 5.35

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WU68 A6NKI8 Q56UU3
Symbols U2af26
U2AF1L3
U2AF1RS3
U2AF1-RS3
U2AF1L3V1

Gene

Gene RIF (4)

PMID Text
27143377 U2AF1L4 gene expression is regulated by cytokines in activated T cells.
23246698 a 269 bp region located between the PSENEN and U2AF1L4 human genes is a genuine bidirectional promoter regulating a concerted divergent transcription of these genes.
22022969 One of the conservative regions is responsible for the enhancer activity and is able to interact with proteins of HeLa cell nuclear extract.
18460468 Differential isoform expression and interaction with the P32 regulatory protein controls the subcellular localization of the splicing factor U2AF26

AA Sequence

MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVS      1 - 70
DVEVQEHYDSFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAV     71 - 140
HGELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISQNLQRQLYGRGPRRRSPPRFHTGHHPRERNHR    141 - 210
CSPDHWHGRF                                                                211 - 220
//

Text Mined References (14)

PMID Year Title
27143377 [Cytokine-mediated regulation of expression of Gfi1 and U2afll4 genes activated by T-cells with different differentiation status in vitro].
23246698 2013 Human PSENEN and U2AF1L4 genes are concertedly regulated by a genuine bidirectional promoter.
22022969 2011 Functional dissection of an enhancer-like element located within the second intron of the human U2AF1L4 gene.
18460468 2008 Differential isoform expression and interaction with the P32 regulatory protein controls the subcellular localization of the splicing factor U2AF26.
17312947 2006 Cloning and characterization of a novel splice variant of human U2AF1L3 gene.
16147880 2005 Cloning and characterization of a novel splice variant of human Rab18 gene (RAB18).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...