Property Summary

NCBI Gene PubMed Count 14
Grant Count 329
R01 Count 245
Funding $31,884,684.15
PubMed Score 13.86
PubTator Score 16.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer 2.300 0.022
osteosarcoma -5.603 0.000
periodontitis 2.700 0.000
tuberculosis 2.400 0.000
interstitial cystitis 4.000 0.000
lung adenocarcinoma 1.300 0.000
pancreatic carcinoma 2.300 0.022
ulcerative colitis 3.300 0.000
cystic fibrosis and chronic rhinosinusit... 1.215 0.013
Chronic obstructive pulmonary disease -1.100 0.033

Synonym

Accession Q8WU39 D2IYS0 Q7Z6N2 Q96RL5 Q9P0T3
Symbols PACAP
pERp1
MEDA-7

Gene

Gene RIF (6)

PMID Text
24014023 miR-185 regulates T cell development through its targeting of several mRNAs including Mzb1.
23434460 results suggested that MGC29506 has the potential of functioning as a novel suppressor gene in gastric cancer
23189934 High expression of MZB1 predicts adverse prognosis in chronic lymphocytic leukemia, follicular lymphoma and diffuse large B-cell lymphoma and is associated with a unique gene expression signature.
22613335 Data show that proapoptotic caspase adapter protein PACAP is a potential serum marker of non-small cell lung cancer.
22573353 methylation-mediated silencing of MZB1 expression leads to loss of its tumor-suppressive activity, which may be a factor in hepatocarcinogenesis
12792799 MGC29506 gene, frequently down-regulated in intestinal-type gastric cancer, was found to encode secreted-type protein with six conserved cysteine residues [MGC29506]

AA Sequence

MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETK      1 - 70
LHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLS     71 - 140
RTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL                         141 - 189
//

Text Mined References (18)

PMID Year Title
24014023 2013 Transgenic expression of microRNA-185 causes a developmental arrest of T cells by targeting multiple genes including Mzb1.
23434460 2013 MGC29506 induces cell cycle arrest and is downregulated in gastric cancer.
23189934 2013 High expression of MZB1 predicts adverse prognosis in chronic lymphocytic leukemia, follicular lymphoma and diffuse large B-cell lymphoma and is associated with a unique gene expression signature.
22613335 2012 [Proteomics-based identification of proapoptotic caspase adapter protein as a novel serum marker of non-small cell lung cancer].
22573353 2012 Integrative array-based approach identifies MZB1 as a frequently methylated putative tumor suppressor in hepatocellular carcinoma.
21688198 2011 Novel hormone-regulated genes in visceral adipose tissue: cloning and identification of proinflammatory cytokine-like mouse and human MEDA-7: implications for obesity, insulin resistance and the metabolic syndrome.
21269460 2011 Initial characterization of the human central proteome.
21093319 2010 Mzb1 protein regulates calcium homeostasis, antibody secretion, and integrin activation in innate-like B cells.
19805157 2009 pERp1 is significantly up-regulated during plasma cell differentiation and contributes to the oxidative folding of immunoglobulin.
19805154 2009 Efficient IgM assembly and secretion require the plasma cell induced endoplasmic reticulum protein pERp1.
More...