Property Summary

NCBI Gene PubMed Count 16
PubMed Score 17.11
PubTator Score 16.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Chronic obstructive pulmonary disease -1.100 3.3e-02
cystic fibrosis and chronic rhinosinusit... 1.109 2.7e-03
interstitial cystitis 3.200 1.6e-03
lung adenocarcinoma 1.300 1.2e-12
osteosarcoma -3.692 7.5e-11
pancreatic cancer 2.100 1.3e-02
pancreatic carcinoma 2.100 1.3e-02
periodontitis 2.100 3.8e-31
tuberculosis 1.700 1.7e-04
ulcerative colitis 2.800 2.6e-05

Gene RIF (8)

AA Sequence

MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETK      1 - 70
LHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLS     71 - 140
RTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL                         141 - 189
//

Text Mined References (20)

PMID Year Title