Knowledge Summary

Patent

No data available

AA Sequence

MKNVANTVTISHILPHIKIIHTEEKPDKCEECNKVFNWSSTHTKYKRIHTEDKFYKYEECDKSFKNISTL      1 - 70
ITHKIIYVVEKFYKCEECGKVFFFFLKWSLTLSPKLECNGAISVHCNLRLLGSSDSLASTSQAAGIAGAC     71 - 140
HHAQLIFVFLVETGFHHFDQAGFELLTSSDPPALASQSAPKCWDYKHEPLSPVECGKVFNKLSNHTGEKL    141 - 210
YKPKRHDSALENTLNFSKHKRNHSVKKP                                              211 - 238
//

Text Mined References (1)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).