Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
posterior fossa group B ependymoma 1,530

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 0.000

Synonym

Accession Q8WTX9 O15461
Symbols ZNF377
C16orf1
HSU90653

Gene

Gene RIF (3)

PMID Text
25299331 In an expression screen for proteins that can activate the IFNB1 promoter, authors identified the ER-associated protein ZDHHC1 as a positive regulator of virus-triggered, MITA/STING-dependent immune signaling.
23687301 In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes.
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MYKMNICNKPSNKTAPEKSVWTAPAQPSGPSPELQGQRSRRNGWSWPPHPLQIVAWLLYLFFAVIGFGIL      1 - 70
VPLLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYAGPLPIFNRSQHAHVIEDLHCNLCN     71 - 140
VDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLFLHSVASALLGVLLLVLVATYVFVEFFVNPMR    141 - 210
LRTNRHFEVLKNHTDVWFVFLPAAPVETQAPAILALAALLILLGLLSTALLGHLLCFHIYLMWHKLTTYE    211 - 280
YIVQHRPPQEAKGVHRELESCPPKMRPIQEMEFYMRTFRHMRPEPPGQAGPAAVNAKHSRPASPDPTPGR    281 - 350
RDCAGPPVQVEWDRKKPLPWRSPLLLLAMWGPQAPPCLCRKRGRGACIKCERLRPRIRRRGLGPPAAAPA    351 - 420
RRRIPRTPALCTPLALPAPTTRRRQSPWTRFQWRRRAWAAPLWPPRGAGADSPRWRGRRVRPPFS         421 - 485
//

Text Mined References (10)

PMID Year Title
25299331 2014 The ER-associated protein ZDHHC1 is a positive regulator of DNA virus-triggered, MITA/STING-dependent innate immune signaling.
23687301 2013 In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10395086 1999 The DHHC domain: a new highly conserved cysteine-rich motif.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.