Property Summary

NCBI Gene PubMed Count 26
PubMed Score 21.78
PubTator Score 18.13

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count
Schizophrenia 503
Disease Target Count Z-score Confidence
Epilepsy 346 0.0 4.0



Accession Q8WTW4 A8K831 Q6FGS2 Q9Y249 Q9Y497 NPR2-like protein
Symbols NPR2


PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (15)

26505888 NPRL2 mutations are significant cause of focal epilepsy.
26044952 NPRL2 acts as a functional tumor suppressor in colorectal cancer cell lines.
25777765 NPRL2 enhances sensitivity to oxaliplatin in colon cancer cells.
25480944 Results provide a set of genetic and biologic proofs that TUSC4 functions as a bona fide tumor suppressor by regulating the protein stability and function of BRCA1 in breast cancer.
24789683 Decreased expression of NPRL2 is associated with renal cancer.
24521741 NPRL2 mRNA blood levels could be a potentially useful marker for the detection of early stage adenomas and colorectal cancers.
23321467 NPRL2 expression is negatively related with the survival of osteosarcoma patients, indicating its value as a prognosis factor of osteosarcoma.
23079973 Lower NPRL2 expression was observed significantly more frequently in poorly differentiated tumor samples than in highly or moderately differentiated colon tumors.
20193080 tumor suppressor genes RBSP3/CTDSPL, NPRL2/G21 and RASSF1A are downregulated in primary non-small cell lung cancer
20154027 Data indicate that Npr2, a homolog of human NPRL2, is a phosphorylation-dependent target of the SCF(Grr1) E3 ubiquitin ligase that plays a role in cell growth on some nitrogen sources.

AA Sequence

YDEICCKTGMSYHELDERLENDPNIIICWK                                            351 - 380

Text Mined References (26)

PMID Year Title
26505888 2016 Mutations in the mammalian target of rapamycin pathway regulators NPRL2 and NPRL3 cause focal epilepsy.
26044952 2015 Functional characterization of the nitrogen permease regulator-like-2 candidate tumor suppressor gene in colorectal cancer cell lines.
25777765 2015 Nitrogen permease regulator-like 2 enhances sensitivity to oxaliplatin in colon cancer cells.
25480944 2015 TUSC4 functions as a tumor suppressor by regulating BRCA1 stability.
24789683 2014 Decreased expression of NPRL2 in renal cancer cells is associated with unfavourable pathological, proliferation and apoptotic features.
24521741 2014 Relationship between tumor and peripheral blood NPRL2 mRNA levels in patients with colorectal adenoma and colorectal cancer.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
23321467 NPRL2 is an independent prognostic factor of osteosarcoma.
23079973 2012 NPRL2 gene expression in the progression of colon tumors.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.