Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.90
PubTator Score 1.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1187 3.7e-11
medulloblastoma, large-cell 6241 7.4e-05
glioblastoma 5792 2.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 5.066 2.5

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.100 2.7e-04
juvenile dermatomyositis -1.151 3.7e-11
medulloblastoma, large-cell -1.200 7.4e-05

Synonym

Accession Q8WTU2 Q2HIZ5 Q6ZMG3 Q96BF5
Symbols SRCRB4D
S4D-SRCRB
SRCRB-S4D

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (3)

AA Sequence

MHKEAEMLIGPQLDEKRWGWRLGDGSAAPPFLPQALSFLLLLPLASALQPTPLPFQELRLVGGPSRCRGR      1 - 70
LEVMHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPILLDNVECRGQEAALSECGSR     71 - 140
GWGVHNCFHYEDVAVLCDEFLPTQPPTRKMLTSRAPPTTLPNGKSEGSVRLVGGANLCQGRVEILHSGLW    141 - 210
GTVCDDDWGLPDAAVVCRQLGCGAAMAATTNAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGH    211 - 280
HEDAGALCAGLGPPTLTALPSSATREDWAWQTDPSATGVGPQPSRETALLTTAAWAAGKKSGRLRLVGGP    281 - 350
GPCRGRVEVLHAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTEARL    351 - 420
SDCFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAHRCEGRVELYL    421 - 490
GQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAH    491 - 560
NCDHSEDASVLCQPS                                                           561 - 575
//

Text Mined References (8)

PMID Year Title