Property Summary

NCBI Gene PubMed Count 22
PubMed Score 82.38
PubTator Score 67.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.3e-31
osteosarcoma 7950 2.3e-10
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Lupus erythematosus 57 3.596 1.8
dermatomyositis 966 3.376 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.576 2.3e-10
psoriasis 2.000 2.3e-31

Gene RIF (18)

AA Sequence

MVPEEEPQDREKGLWWFQLKVWSMAVVSILLLSVCFTVSSVVPHNFMYSKTVKRLSKLREYQQYHPSLTC      1 - 70
VMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSY     71 - 140
FLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKK    141 - 210
IYI                                                                       211 - 213
//

Text Mined References (22)

PMID Year Title