Property Summary

NCBI Gene PubMed Count 40
PubMed Score 94.77
PubTator Score 60.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Chanarin-Dorfman Syndrome 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Neutral lipid storage disease 12 7.717 3.9
Disease Target Count Z-score Confidence
Cataract 297 0.0 4.0

Expression

  Differential Expression (8)

Disease log2 FC p
esophageal adenocarcinoma -1.600 2.5e-02
glioblastoma 1.100 4.5e-03
lung cancer -1.200 2.3e-02
lung carcinoma -1.100 7.3e-15
mucosa-associated lymphoid tissue lympho... 1.020 1.3e-02
non diabetic and post-ischemic heart fai... -1.200 3.2e-02
osteosarcoma -2.143 5.0e-04
spina bifida -2.349 4.6e-02

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (33)

AA Sequence

MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSH      1 - 70
NISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRC     71 - 140
ALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNP    141 - 210
LAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQR    211 - 280
IGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD     281 - 349
//

Text Mined References (43)

PMID Year Title