Property Summary

NCBI Gene PubMed Count 35
Grant Count 201
R01 Count 83
Funding $50,632,642.28
PubMed Score 87.94
PubTator Score 60.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
esophageal adenocarcinoma -1.600 0.025
osteosarcoma -2.143 0.001
glioblastoma 1.100 0.004
non diabetic and post-ischemic heart fai... -1.200 0.032
lung cancer -1.400 0.000
lung carcinoma -1.100 0.000
spina bifida -2.349 0.046
mucosa-associated lymphoid tissue lympho... 1.020 0.013

Synonym

Accession Q8WTS1 B2R9K0 Q9Y369
Symbols CDS
CGI58
IECN2
NCIE2

Gene

PANTHER Protein Class (3)

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
493027 screening 45 / 0 / 1937 Luminescence-based biochemical high throughput validation assay to identify inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-1 (PLIN1)
493035 screening 46 / 0 / 1936 Luminescence-based biochemical high throughput validation assay to identify inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5)
493057 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-1 (PLIN1)
493241 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with the muscle lipid droplet protein, perilipin-5 (PLIN5; MLDP)
504317 confirmatory 32 / 0 / 13 Luminescence-based biochemical high throughput dose response assay for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-1 (PLIN1) (2K validation set)
602281 screening 2853 / 0 / 361278 Luminescence-based biochemical primary high throughput screening assay to identify inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5)
651612 screening 1513 / 0 / 736 Luminescence-based biochemical high throughput confirmation assay for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5)
651677 confirmatory 198 / 0 / 36 Luminescence-based biochemical high throughput dose response assay for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5)
651733 confirmatory 186 / 0 / 48 Luminescence-based biochemical high throughput dose response assay for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5) produced in HEK293T cells
651759 confirmatory 32 / 0 / 16 Late stage luminescence-based biochemical dose response assay for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5) produced in HEK293T cells
More...

Gene RIF (28)

PMID Text
26353074 novel ABHD5 truncating variant in a twenty nine month old female child, who presented with icthyosiform erythroderma.
26350461 simultaneous tryptophan alanine permutations in both arms abolish localization and activity of CGI-58 as opposed to tryptophan substitutions that occur in only one arm.
26330055 Authors show that rat ATGL, coactivated by rat CGI-58, efficiently hydrolyzes triglycerides and retinyl ester.
25682902 this study presents clinical and molecular data of four affected relatives with Chanarin-Dorfman syndrome homozygous for a N209X mutation in ABHD5, and provides a short review by comparing patients with N209X homozygous mutations to patients with other ABHD5 mutations.
25482557 Abhd5 expression falls substantially and correlates negatively with malignant features in human colorectal cancer.
25421061 -mediated phosphorylation of CGI-58 is required for dispersion of CGI-58 from perilipin 1A-coated lipid droplets
25315780 Findings indicate a molecular mechanisms by which lysophosphatidic acid acyltransferase CGI-58 regulates lipid homeostasis.
25054327 PLIN5 was significantly colocated with ATGL, mitochondria and CGI-58, indicating a close association between the key lipolytic effectors in resting skeletal muscle.
23557589 ABHD5, PGRMC1 and SQS are novel markers for sebaceous carcinoma and can reliably distinguish sebaceous neoplasms from non-sebaceous tumors, specifically BCC with clear cell features.
22383684 an important metabolic function of CGI-58 in skeletal muscle
More...

AA Sequence

MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSH      1 - 70
NISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRC     71 - 140
ALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNP    141 - 210
LAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQR    211 - 280
IGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD     281 - 349
//

Text Mined References (38)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26353074 2016 Chanarin Dorfman syndrome: a case report with novel nonsense mutation.
26350461 2015 Structure of a CGI-58 motif provides the molecular basis of lipid droplet anchoring.
26330055 2015 ATGL and CGI-58 are lipid droplet proteins of the hepatic stellate cell line HSC-T6.
25682902 2015 Chanarin-Dorfman syndrome: Genotype-Phenotype Correlation.
25482557 2014 Loss of abhd5 promotes colorectal tumor development and progression by inducing aerobic glycolysis and epithelial-mesenchymal transition.
25421061 2015 CGI-58/ABHD5 is phosphorylated on Ser239 by protein kinase A: control of subcellular localization.
25315780 2014 Comparative gene identification-58 (CGI-58) promotes autophagy as a putative lysophosphatidylglycerol acyltransferase.
25054327 2014 Cellular localization and associations of the major lipolytic proteins in human skeletal muscle at rest and during exercise.
23557589 2013 Lipid synthesis and processing proteins ABHD5, PGRMC1 and squalene synthase can serve as novel immunohistochemical markers for sebaceous neoplasms and differentiate sebaceous carcinoma from sebaceoma and basal cell carcinoma with clear cell features.
More...