Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.75
PubTator Score 4.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
gastric carcinoma 832

Expression

  Differential Expression (1)

Disease log2 FC p
gastric carcinoma -1.200 0.011

Gene RIF (2)

PMID Text
21989941 crystal structure of SKRP1 (C150S) has been determined and refined at 1.26 A resolution (Table I). The structure reveals 142 residues (residues 65-206) of SKRP1 and three ions (two sulfates and one phosphate) at the catalytic site
12479873 LMW-DSP3 was expressed in the heart, lung, liver, and pancreas, and the expression level in the pancreas was highest. The LMW-DSP3 gene was located in human chromosome 2q32, and consisted of five exons spanning 21kb of human genomic DNA[LMW-DSP3]

AA Sequence

MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIK      1 - 70
PWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAK     71 - 140
RKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCD    141 - 210
RIQENSS                                                                   211 - 217
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21989941 2011 Crystal structure of a novel mitogen-activated protein kinase phosphatase, SKRP1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19228121 2009 Dual-specificity phosphatases: critical regulators with diverse cellular targets.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12479873 2003 Molecular cloning and characterization of a novel human protein phosphatase, LMW-DSP3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...