Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.75
PubTator Score 4.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
gastric carcinoma 832 0.0105278515103579

Expression

  Differential Expression (1)

Disease log2 FC p
gastric carcinoma -1.200 0.011

Synonym

Accession Q8WTR2 B2RA79 Q547H4 Q8WYN4
Symbols SKRP1
DUSP17
LMWDSP3
TS-DSP1

Gene

PDB

3S4E   4D3P   4D3Q   4D3R  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
21989941 crystal structure of SKRP1 (C150S) has been determined and refined at 1.26 A resolution (Table I). The structure reveals 142 residues (residues 65-206) of SKRP1 and three ions (two sulfates and one phosphate) at the catalytic site
12479873 LMW-DSP3 was expressed in the heart, lung, liver, and pancreas, and the expression level in the pancreas was highest. The LMW-DSP3 gene was located in human chromosome 2q32, and consisted of five exons spanning 21kb of human genomic DNA[LMW-DSP3]

AA Sequence

MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIK      1 - 70
PWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAK     71 - 140
RKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCD    141 - 210
RIQENSS                                                                   211 - 217
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21989941 2011 Crystal structure of a novel mitogen-activated protein kinase phosphatase, SKRP1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19228121 2009 Dual-specificity phosphatases: critical regulators with diverse cellular targets.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12479873 2003 Molecular cloning and characterization of a novel human protein phosphatase, LMW-DSP3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...