Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.54
PubTator Score 43.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 6.4695252113551E-10
tuberculosis 1563 1.00581177206719E-7
psoriasis 6685 4.04878442119995E-6
sarcoidosis 368 4.83523315576133E-6
posterior fossa group A ependymoma 1511 6.4063264489548E-6
pancreatic cancer 2300 1.21617801848237E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.48467849087523E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00163903325711033
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0022727192016455
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00319574279331587
acute myeloid leukemia 785 0.00511945798671548
atypical teratoid/rhabdoid tumor 1095 0.0101892449186071
invasive ductal carcinoma 2950 0.0156025718665206
ovarian cancer 8492 0.0156680614293516
interstitial cystitis 2299 0.0219947363727907
cutaneous lupus erythematosus 1056 0.0231077006635752
Atopic dermatitis 944 0.0278577678404728
gastric carcinoma 832 0.0289809128100484
Disease Target Count Z-score Confidence
Allan-Herndon-Dudley syndrome 11 5.703 2.9
Euthyroid sick syndrome 5 3.648 1.8

Expression

Synonym

Accession Q8TF71 B3KWY0 Q6ZMG0 Q8WVI5 MCT 10
Symbols TAT1
MCT10
PRO0813

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (6)

PMID Text
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of solute carrier family 16 (aromatic amino acid transporter), member 10 (SLC16A10) in peptide-treated PBMCs
21508134 The strong expression of MCT10 and OATP1C1 in the human hypothalamus indicates a possible role in the regulation of the hypothalamus-pituitary-thyroid axis.
21486766 Compared with the adult cerebral cortex, mRNAs encoding OATP1A2, OATP1C1, OATP3A1 variant 2, OATP4A1, LAT2 and CD98 were reduced in fetal cortex at different gestational ages, whilst mRNAs encoding MCT8, MCT10, OATP3A1 variant 1 and LAT1 were similar.
21315799 monocarboxylate transporter 10 facilitates bromoacetyl [(125)I] iodothyronine transport, but is not labeled by it
20167367 Increased MCT8 and decreased MCT10 expression within placentae of pregnancies complicated by IUGR may contribute to aberrant development of the fetoplacental unit.
18337592 MCT10 is at least as active a thyroid hormone transporter as hMCT8, and that both transporters facilitate iodothyronine uptake as well as efflux.

AA Sequence

MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHEPPEPPEGGWG      1 - 70
WLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSLSMGMIFFCCPIVSVFTDLFG     71 - 140
CRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGCSFAYQPSLVILGHYFKKRLGLVNGIVTAGS    141 - 210
SVFTILLPLLLRVLIDSVGLFYTLRVLCIFMFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPK    211 - 280
KIFNFAIFKVTAYAVWAVGIPLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIA    281 - 350
DYVPGVKKVYLQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAI    351 - 420
GFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREISKTTGKEKME    421 - 490
KMLENQNSLLSSSSGMFKKESDSII                                                 491 - 515
//

Text Mined References (20)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21508134 2011 Expression of thyroid hormone transporters in the human hypothalamus.
21486766 2011 The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21315799 2011 The thyroid hormone transporters MCT8 and MCT10 transport the affinity-label N-bromoacetyl-[(125)I]T3 but are not modified by it.
20167367 2010 Expression of thyroid hormone transporters in the human placenta and changes associated with intrauterine growth restriction.
18337592 2008 Effective cellular uptake and efflux of thyroid hormone by human monocarboxylate transporter 10.
More...