Property Summary

NCBI Gene PubMed Count 18
PubMed Score 19.22
PubTator Score 43.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia -1.100 5.1e-03
Atopic dermatitis -1.300 2.8e-02
atypical teratoid/rhabdoid tumor 1.100 1.0e-02
cutaneous lupus erythematosus -1.600 2.3e-02
ependymoma 1.400 7.7e-06
gastric carcinoma -2.400 2.9e-02
interstitial cystitis 1.600 2.2e-02
intraductal papillary-mucinous adenoma (... -2.300 8.5e-04
intraductal papillary-mucinous carcinoma... -2.200 2.6e-03
intraductal papillary-mucinous neoplasm ... -2.500 7.9e-03
invasive ductal carcinoma 1.678 1.6e-02
lung carcinoma -1.600 6.5e-10
ovarian cancer 1.200 3.6e-05
pancreatic cancer -2.100 6.4e-06
pancreatic ductal adenocarcinoma liver m... -1.499 1.6e-03
psoriasis 2.100 4.0e-06
sarcoidosis -1.200 4.8e-06
tuberculosis -2.400 2.8e-05

Gene RIF (9)

AA Sequence

MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHEPPEPPEGGWG      1 - 70
WLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSLSMGMIFFCCPIVSVFTDLFG     71 - 140
CRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGCSFAYQPSLVILGHYFKKRLGLVNGIVTAGS    141 - 210
SVFTILLPLLLRVLIDSVGLFYTLRVLCIFMFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPK    211 - 280
KIFNFAIFKVTAYAVWAVGIPLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIA    281 - 350
DYVPGVKKVYLQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAI    351 - 420
GFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREISKTTGKEKME    421 - 490
KMLENQNSLLSSSSGMFKKESDSII                                                 491 - 515
//

Text Mined References (23)

PMID Year Title