Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.36
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
nephrosclerosis -1.712 0.003
malignant mesothelioma -2.500 0.000
esophageal adenocarcinoma 1.400 0.018
cutaneous lupus erythematosus -1.400 0.003
psoriasis -1.600 0.002
osteosarcoma -2.579 0.000
adrenocortical carcinoma -3.177 0.000
non-small cell lung cancer -1.296 0.000
lung cancer -3.600 0.000
cystic fibrosis -1.200 0.002
lung adenocarcinoma -1.400 0.000
lung carcinoma -1.200 0.000
Breast cancer -2.500 0.000
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -2.000 0.000
ulcerative colitis -1.900 0.000
ovarian cancer -3.000 0.000
pituitary cancer 1.800 0.005

Gene RIF (2)

PMID Text
18978678 Observational study of gene-disease association. (HuGE Navigator)
11836570 Molecular cloning and characterization of human GIPC2, a novel gene homologous to human GIPC1 and Xenopus Kermit

AA Sequence

MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAHGSATGRVEGFSSIQELYAQI      1 - 70
AGAFEISPSEILYCTLNTPKIDMERLLGGQLGLEDFIFAHVKGIEKEVNVYKSEDSLGLTITDNGVGYAF     71 - 140
IKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKAFEIELRSKA    141 - 210
GKSSGEKIGCGRATLRLRSKGPATVEEMPSETKAKAIEKIDDVLELYMGIRDIDLATTMFEAGKDKVNPD    211 - 280
EFAVALDETLGDFAFPDEFVFDVWGVIGDAKRRGL                                       281 - 315
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...