Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.88
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -3.099 5.7e-04
Breast cancer -2.000 5.8e-33
cutaneous lupus erythematosus -1.400 2.7e-03
cystic fibrosis -1.200 1.6e-03
ductal carcinoma in situ -1.500 1.3e-04
esophageal adenocarcinoma 1.400 1.8e-02
invasive ductal carcinoma -2.000 1.3e-04
lung adenocarcinoma -1.400 2.8e-14
lung cancer -1.100 3.2e-02
lung carcinoma -1.200 1.2e-13
malignant mesothelioma -2.500 5.3e-07
nephrosclerosis -1.712 2.9e-03
non-small cell lung cancer -1.296 7.6e-16
osteosarcoma -2.579 2.9e-04
ovarian cancer -2.700 1.6e-10
pituitary cancer 1.800 4.7e-03
psoriasis -1.600 2.0e-03
ulcerative colitis -1.300 2.0e-03

Synonym

Accession Q8TF65 Q8IYD3 Q9NXS7
Symbols SEMCAP2
SEMCAP-2

Gene

PANTHER Protein Class (2)

PDB

3GGE  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAHGSATGRVEGFSSIQELYAQI      1 - 70
AGAFEISPSEILYCTLNTPKIDMERLLGGQLGLEDFIFAHVKGIEKEVNVYKSEDSLGLTITDNGVGYAF     71 - 140
IKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKAFEIELRSKA    141 - 210
GKSSGEKIGCGRATLRLRSKGPATVEEMPSETKAKAIEKIDDVLELYMGIRDIDLATTMFEAGKDKVNPD    211 - 280
EFAVALDETLGDFAFPDEFVFDVWGVIGDAKRRGL                                       281 - 315
//

Text Mined References (15)

PMID Year Title