Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.45
PubTator Score 11.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL RECESSIVE 15 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 4.789 2.4
Disease Target Count Z-score Confidence
Hodgkin's lymphoma, nodular sclerosis 22 3.501 1.8

Expression

Gene RIF (8)

AA Sequence

MEGAAAREARGTETPRASAPPPAPSEPPAAPRARPRLVFRTQLAHGSPTGKIEGFTNVRELYAKIAEAFG      1 - 70
IAPTEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTEDALGLTITDNGAGYAFIKRIK     71 - 140
EGSIINRIEAVCVGDSIEAINDHSIVGCRHYEVAKMLRELPKSQPFTLRLVQPKRAFDMIGQRSRSSKCP    141 - 210
VEAKVTSGRETLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPELASTMVETSKKTASAQEFA    211 - 280
RCLDSVLGEFAFPDEFVVEVWAAIGEAREACG                                          281 - 312
//

Text Mined References (15)

PMID Year Title