Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.45
PubTator Score 11.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL RECESSIVE 15 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 4.789 2.4
Disease Target Count Z-score Confidence
Hodgkin's lymphoma, nodular sclerosis 22 3.501 1.8

Expression

Synonym

Accession Q8TF64 O75227
Symbols DFNB15
DFNB72
DFNB95
C19orf64

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (8)

AA Sequence

MEGAAAREARGTETPRASAPPPAPSEPPAAPRARPRLVFRTQLAHGSPTGKIEGFTNVRELYAKIAEAFG      1 - 70
IAPTEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTEDALGLTITDNGAGYAFIKRIK     71 - 140
EGSIINRIEAVCVGDSIEAINDHSIVGCRHYEVAKMLRELPKSQPFTLRLVQPKRAFDMIGQRSRSSKCP    141 - 210
VEAKVTSGRETLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPELASTMVETSKKTASAQEFA    211 - 280
RCLDSVLGEFAFPDEFVVEVWAAIGEAREACG                                          281 - 312
//

Text Mined References (15)

PMID Year Title