Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.76
PubTator Score 12.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma 1.326 1.2e-03
Alzheimer's disease 1.100 2.9e-02
Astrocytoma, Pilocytic -1.100 1.9e-07
group 4 medulloblastoma 1.200 8.7e-07
juvenile dermatomyositis 1.295 4.6e-11
osteosarcoma -1.412 1.2e-04
ovarian cancer -1.200 4.7e-06
Pick disease 1.500 1.2e-05
primary pancreatic ductal adenocarcinoma 1.085 4.1e-03

Gene RIF (1)

AA Sequence

MAPRPPTAAPQESVTFKDVSVDFTQEEWYHVDPAQRSLYRDVMLENYSHLVSLGYQVSKPEVIFKLEQGE      1 - 70
EPWISEGEIQRPFYPDWKTRPEVKSSHLQQDVSEVSHCTHDLLHATLEDSWDVSSQLDRQQENWKRHLGS     71 - 140
EASTQKKIITPQENFEQNKFGENSRLNTNLVTQLNIPARIRPSECETLGSNLGHNADLLNENNILAKKKP    141 - 210
YKCDKCRKAFIHRSSLTKHEKTHKGEGAFPNGTDQGIYPGKKHHECTDCGKTFLWKTQLTEHQRIHTGEK    211 - 280
PFECNVCGKAFRHSSSLGQHENAHTGEKPYQCSLCGKAFQRSSSLVQHQRIHTGEKPYRCNLCGRSFRHG    281 - 350
TSLTQHEVTHSGEKPFQCKECGKAFSRCSSLVQHERTHTGEKPFECSICGRAFGQSPSLYKHMRIHKRGK    351 - 420
PYQSSNYSIDFKHSTSLTQDESTLTEVKSYHCNDCGEDFSHITDFTDHQRIHTAENPYDCEQAFSQQAIS    421 - 490
HPGEKPYQCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSLTQHERTHTGEKPYECIDCGK    491 - 560
AFSQSSSLIQHERTHTGEKPYECNECGRAFRKKTNLHDHQRIHTGEKPYSCKECGKNFSRSSALTKHQRI    561 - 630
HTRNKL                                                                    631 - 636
//

Text Mined References (17)

PMID Year Title