Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.95
PubTator Score 12.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 4.62178930241966E-11
pilocytic astrocytoma 3086 4.28873435627798E-7
ovarian cancer 8492 5.42755832258921E-6
Pick disease 1893 1.19370949859131E-5
osteosarcoma 7933 2.01921391689265E-5
group 4 medulloblastoma 1875 1.53332863182646E-4
adrenocortical carcinoma 1427 0.00121327145366754
primary pancreatic ductal adenocarcinoma 1271 0.00408915671146039
Alzheimer's disease 644 0.0293099969230488
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Schizophrenia 503 0.0 1.0
ulcerative colitis 2087 0.0 2.0
Disease Target Count Z-score Confidence
Optic atrophy 43 3.146 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.378 0.000
juvenile dermatomyositis 1.295 0.000
adrenocortical carcinoma 1.326 0.001
primary pancreatic ductal adenocarcinoma 1.085 0.004
group 4 medulloblastoma 1.400 0.000
pilocytic astrocytoma -1.100 0.000
Alzheimer's disease 1.100 0.029
Pick disease 1.500 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q8TF47 B2RU00 B3KVE7 L7S2P3 Q49AD1 Q96MQ6 Zfp-90
Symbols FIK
NK10
ZNF756
zfp-90

Gene

  Ortholog (5)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAPRPPTAAPQESVTFKDVSVDFTQEEWYHVDPAQRSLYRDVMLENYSHLVSLGYQVSKPEVIFKLEQGE      1 - 70
EPWISEGEIQRPFYPDWKTRPEVKSSHLQQDVSEVSHCTHDLLHATLEDSWDVSSQLDRQQENWKRHLGS     71 - 140
EASTQKKIITPQENFEQNKFGENSRLNTNLVTQLNIPARIRPSECETLGSNLGHNADLLNENNILAKKKP    141 - 210
YKCDKCRKAFIHRSSLTKHEKTHKGEGAFPNGTDQGIYPGKKHHECTDCGKTFLWKTQLTEHQRIHTGEK    211 - 280
PFECNVCGKAFRHSSSLGQHENAHTGEKPYQCSLCGKAFQRSSSLVQHQRIHTGEKPYRCNLCGRSFRHG    281 - 350
TSLTQHEVTHSGEKPFQCKECGKAFSRCSSLVQHERTHTGEKPFECSICGRAFGQSPSLYKHMRIHKRGK    351 - 420
PYQSSNYSIDFKHSTSLTQDESTLTEVKSYHCNDCGEDFSHITDFTDHQRIHTAENPYDCEQAFSQQAIS    421 - 490
HPGEKPYQCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSLTQHERTHTGEKPYECIDCGK    491 - 560
AFSQSSSLIQHERTHTGEKPYECNECGRAFRKKTNLHDHQRIHTGEKPYSCKECGKNFSRSSALTKHQRI    561 - 630
HTRNKL                                                                    631 - 636
//

Text Mined References (16)

PMID Year Title
23543754 2013 Cutting Edge: a novel, human-specific interacting protein couples FOXP3 to a chromatin-remodeling complex that contains KAP1/TRIM28.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21284946 2011 Zinc-finger protein 90 negatively regulates neuron-restrictive silencer factor-mediated transcriptional repression of fetal cardiac genes.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15852396 2005 Spastic paraplegia, optic atrophy, and neuropathy is linked to chromosome 11q13.
More...