Property Summary

NCBI Gene PubMed Count 13
Grant Count 20
R01 Count 8
Funding $3,274,151.73
PubMed Score 6.17
PubTator Score 4.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma -1.500 0.000
osteosarcoma 2.652 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.400 0.001
medulloblastoma 1.100 0.001
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 1.100 0.032
adrenocortical carcinoma 1.038 0.001
tuberculosis -1.400 0.000
psoriasis -1.300 0.000
spina bifida -2.185 0.043
Pick disease 1.600 0.003
ovarian cancer -1.400 0.000

Gene RIF (4)

PMID Text
22709692 The FLCN-FNIP complex deregulated in Birt-Hogg-Dube syndrome is absolutely required for B-cell differentiation.
22190034 HIV-1 PR is identified to have a physical interaction with folliculin interacting protein 1 (FNIP1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18804346 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17028174 Results suggest that FLCN, mutated in Birt-Hogg-Dube syndrome, and its interacting partner FNIP1 may be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways.

AA Sequence

MAPTLFQKLFSKRTGLGAPGRDARDPDCGFSWPLPEFDPSQIRLIVYQDCERRGRNVLFDSSVKRRNEDI      1 - 70
SVSKLGSDAQVKVFGKCCQLKPGGDSSSSLDSSVTSSSDIKDQCLKYQGSRCSSDANMLGEMMFGSVAMS     71 - 140
YKGSTLKIHQIRSPPQLMLSKVFTARTGSSICGSLNTLQDSLEFINQDNNTLKADNNTVINGLLGNIGLS    141 - 210
QFCSPRRAFSEQGPLRLIRSASFFAVHSNPMDMPGRELNEDRDSGIARSASLSSLLITPFPSPNSSLTRS    211 - 280
CASSYQRRWRRSQTTSLENGVFPRWSIEESFNLSDESCGPNPGIVRKKKIAIGVIFSLSKDEDENNKFNE    281 - 350
FFFSHFPLFESHMNKLKSAIEQAMKMSRRSADASQRSLAYNRIVDALNEFRTTICNLYTMPRIGEPVWLT    351 - 420
MMSGTPEKNHLCYRFMKEFTFLMENASKNQFLPALITAVLTNHLAWVPTVMPNGQPPIKIFLEKHSSQSV    421 - 490
DMLAKTHPYNPLWAQLGDLYGAIGSPVRLARTVVVGKRQDMVQRLLYFLTYFIRCSELQETHLLENGEDE    491 - 560
AIVMPGTVITTTLEKGEIEESEYVLVTMHRNKSSLLFKESEEIRTPNCNCKYCSHPLLGQNVENISQQER    561 - 630
EDIQNSSKELLGISDECQMISPSDCQEENAVDVKQYRDKLRTCFDAKLETVVCTGSVPVDKCALSESGLE    631 - 700
STEETWQSEKLLDSDSHTGKAMRSTGMVVEKKPPDKIVPASFSCEAAQTKVTFLIGDSMSPDSDTELRSQ    701 - 770
AVVDQITRHHTKPLKEERGAIDQHQETKQTTKDQSGESDTQNMVSEEPCELPCWNHSDPESMSLFDEYFN    771 - 840
DDSIETRTIDDVPFKTSTDSKDHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCFPQQDQRDTLS    841 - 910
ILVPHGDKESSDKKIAVGTEWDIPRNESSDSALGDSESEDTGHDMTRQVSSYYGGEQEDWAEEDEIPFPG    911 - 980
SKLIEVSAVQPNIANFGRSLLGGYCSSYVPDFVLQGIGSDERFRQCLMSDLSHAVQHPVLDEPIAEAVCI    981 - 1050
IADMDKWTVQVASSQRRVTDNKLGKEVLVSSLVSNLLHSTLQLYKHNLSPNFCVMHLEDRLQELYFKSKM   1051 - 1120
LSEYLRGQMRVHVKELGVVLGIESSDLPLLAAVASTHSPYVAQILL                           1121 - 1166
//

Text Mined References (22)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
25126726 2014 FLCN, a novel autophagy component, interacts with GABARAP and is regulated by ULK1 phosphorylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22977732 2012 Crystal structure of folliculin reveals a hidDENN function in genetically inherited renal cancer.
22709692 2012 The folliculin-FNIP1 pathway deleted in human Birt-Hogg-Dubé syndrome is required for murine B-cell development.
22190034 2011 Global landscape of HIV-human protein complexes.
21209915 2010 Inactivation of the FLCN tumor suppressor gene induces TFE3 transcriptional activity by increasing its nuclear localization.
20562859 2010 Network organization of the human autophagy system.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...