Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.73
PubTator Score 4.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.038 1.2e-03
atypical teratoid / rhabdoid tumor 1.400 3.6e-04
glioblastoma 1.400 1.1e-03
group 4 medulloblastoma 1.100 4.7e-03
hepatocellular carcinoma -1.500 3.7e-04
medulloblastoma, large-cell 1.600 3.7e-04
osteosarcoma 2.652 7.4e-07
ovarian cancer -1.400 1.9e-08
Pick disease 1.600 2.9e-03
primitive neuroectodermal tumor 1.100 3.2e-02
psoriasis -1.300 4.5e-06
spina bifida -2.185 4.3e-02
tuberculosis -1.400 4.7e-05

Gene RIF (4)

AA Sequence

MAPTLFQKLFSKRTGLGAPGRDARDPDCGFSWPLPEFDPSQIRLIVYQDCERRGRNVLFDSSVKRRNEDI      1 - 70
SVSKLGSDAQVKVFGKCCQLKPGGDSSSSLDSSVTSSSDIKDQCLKYQGSRCSSDANMLGEMMFGSVAMS     71 - 140
YKGSTLKIHQIRSPPQLMLSKVFTARTGSSICGSLNTLQDSLEFINQDNNTLKADNNTVINGLLGNIGLS    141 - 210
QFCSPRRAFSEQGPLRLIRSASFFAVHSNPMDMPGRELNEDRDSGIARSASLSSLLITPFPSPNSSLTRS    211 - 280
CASSYQRRWRRSQTTSLENGVFPRWSIEESFNLSDESCGPNPGIVRKKKIAIGVIFSLSKDEDENNKFNE    281 - 350
FFFSHFPLFESHMNKLKSAIEQAMKMSRRSADASQRSLAYNRIVDALNEFRTTICNLYTMPRIGEPVWLT    351 - 420
MMSGTPEKNHLCYRFMKEFTFLMENASKNQFLPALITAVLTNHLAWVPTVMPNGQPPIKIFLEKHSSQSV    421 - 490
DMLAKTHPYNPLWAQLGDLYGAIGSPVRLARTVVVGKRQDMVQRLLYFLTYFIRCSELQETHLLENGEDE    491 - 560
AIVMPGTVITTTLEKGEIEESEYVLVTMHRNKSSLLFKESEEIRTPNCNCKYCSHPLLGQNVENISQQER    561 - 630
EDIQNSSKELLGISDECQMISPSDCQEENAVDVKQYRDKLRTCFDAKLETVVCTGSVPVDKCALSESGLE    631 - 700
STEETWQSEKLLDSDSHTGKAMRSTGMVVEKKPPDKIVPASFSCEAAQTKVTFLIGDSMSPDSDTELRSQ    701 - 770
AVVDQITRHHTKPLKEERGAIDQHQETKQTTKDQSGESDTQNMVSEEPCELPCWNHSDPESMSLFDEYFN    771 - 840
DDSIETRTIDDVPFKTSTDSKDHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCFPQQDQRDTLS    841 - 910
ILVPHGDKESSDKKIAVGTEWDIPRNESSDSALGDSESEDTGHDMTRQVSSYYGGEQEDWAEEDEIPFPG    911 - 980
SKLIEVSAVQPNIANFGRSLLGGYCSSYVPDFVLQGIGSDERFRQCLMSDLSHAVQHPVLDEPIAEAVCI    981 - 1050
IADMDKWTVQVASSQRRVTDNKLGKEVLVSSLVSNLLHSTLQLYKHNLSPNFCVMHLEDRLQELYFKSKM   1051 - 1120
LSEYLRGQMRVHVKELGVVLGIESSDLPLLAAVASTHSPYVAQILL                           1121 - 1166
//

Text Mined References (22)

PMID Year Title