Property Summary

NCBI Gene PubMed Count 14
Grant Count 11
R01 Count 11
Funding $1,201,614.75
PubMed Score 7.57
PubTator Score 6.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
21761364 Data show abundant mPRalpha (PAQR7), mPRbeta (PAQR8), and mPRgamma (PAQR5), but not classical nuclear PR (A or B isoforms) mRNA expression and mPRalpha protein expression in a panel of commonly used ovarian cancer cell lines.
18603275 Heterologous expression of MPRB in yeast confirms its ability to function as a membrane progesterone receptor.
11676489 LMPB1 is indeed an integral membrane protein that targets to lysosomal structures.

AA Sequence

MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLF      1 - 70
QKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSH     71 - 140
YTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRK    141 - 210
ICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGH    211 - 280
GHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLT    281 - 350
KKDS                                                                      351 - 354
//

Text Mined References (14)

PMID Year Title
21761364 2010 Expression of membrane progesterone receptors (mPR/PAQR) in ovarian cancer cells: implications for progesterone-induced signaling events.
18603275 2008 Heterologous expression of human mPRalpha, mPRbeta and mPRgamma in yeast confirms their ability to function as membrane progesterone receptors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16044242 2005 PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12606724 2003 The further redefining of steroid-mediated signaling.
12601167 2003 Identification, classification, and partial characterization of genes in humans and other vertebrates homologous to a fish membrane progestin receptor.
More...