Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.46
PubTator Score 15.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma -1.300 1.5e-04
aldosterone-producing adenoma -1.012 4.4e-02
astrocytic glioma 1.200 1.1e-02
Astrocytoma, Pilocytic 1.200 1.0e-06
atypical teratoid / rhabdoid tumor 1.100 2.1e-04
Breast cancer -1.300 1.6e-13
breast carcinoma -1.300 1.9e-04
cystic fibrosis -1.300 4.2e-04
dermatomyositis 1.400 8.0e-04
ductal carcinoma in situ -1.200 3.0e-03
ependymoma 1.400 4.4e-02
glioblastoma 1.400 2.5e-09
group 3 medulloblastoma 1.500 9.9e-03
intraductal papillary-mucinous adenoma (... 1.300 4.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 9.6e-03
invasive ductal carcinoma -1.700 2.2e-03
lung adenocarcinoma -1.200 1.4e-06
lung cancer -1.700 4.4e-03
malignant mesothelioma -1.400 2.1e-06
medulloblastoma, large-cell -1.300 2.2e-05
oligodendroglioma 1.200 5.3e-03
osteosarcoma -1.205 5.2e-03
ovarian cancer -1.300 2.0e-04
primitive neuroectodermal tumor 1.200 7.6e-04
psoriasis -1.800 2.1e-08
tuberculosis 1.300 5.5e-06

Gene RIF (1)

AA Sequence

MEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLAKVQQEACAQY      1 - 70
SGFLFFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLALKCLAPGGGRVQEVPVPNEA     71 - 140
CAYLFTPEWLQGINKDRPTGRLSTCLLSAPSGIQRLPWAELICPRFVHKEGLMVGHQPSTLPPELPSGPP    141 - 210
GLPSPPLPEEALGTRSPGDGHNAPVEGPEGEYVELLEVTLPVRGSPTDAEGSPGLSRVRTVPTRKGAGGK    211 - 280
GRHRRHRAWMHQKGLGPRGQDGARPPGEGSSTGASPESPPGAEAVPEAAVLEVSEPPAEAVGEASGSCPL    281 - 350
RPGELRGGGGGGQGAEGPPGTPRRTGKGNRRKKRAAGRGALSRGGDSAPLSPGDKEDASHQEALGNLPSP    351 - 420
SEHKLPECHLVKEEYEGSGKPESEPKELKTAGEKEPQLSEACGPTEEGAGERELEGPGLLCMAGHTGPEG    421 - 490
PLSDTPTPPLETVQEGKGDNIPEEALAVSVSDHPDVAWDLMASGFLILTGGVDQSGRALLTITPPCPPEE    491 - 560
PPPSRDTLNTTLHYLHSLLRPDLQTLGLSVLLDLRQAPPLPPALIPALSQLQDSGDPPLVQRLLILIHDD    561 - 630
LPTELCGFQGAEVLSENDLKRVAKPEELQWELGGHRDPSPSHWVEIHQEVVRLCRLCQGVLGSVRQAIEE    631 - 700
LEGAAEPEEEEAVGMPKPLQKVLADPRLTALQRDGGAILMRLRSTPSSKLEGQGPATLYQEVDEAIHQLV    701 - 770
RLSNLHVQQQEQRQCLRRLQQVLQWLSGPGEEQLASFAMPGDTLSALQETELRFRAFSAEVQERLAQARE    771 - 840
ALALEENATSQKVLDIFEQRLEQVESGLHRALRLQRFFQQAHEWVDEGFARLAGAGPGREAVLAALALRR    841 - 910
APEPSAGTFQEMRALALDLGSPAALREWGRCQARCQELERRIQQHVGEEASPRGYRRRRADGASSGGAQW    911 - 980
GPRSPSPSLSSLLLPSSPGPRPAPSHCSLAPCGEDYEEEGPELAPEAEGRPPRAVLIRGLEVTSTEVVDR    981 - 1050
TCSPREHVLLGRARGPDGPWGVGTPRMERKRSISAQQRLVSELIACEQDYVATLSEPVPPPGPELTPELR   1051 - 1120
GTWAAALSARERLRSFHRTHFLRELQGCATHPLRIGACFLRHGDQFSLYAQYVKHRHKLENGLAALSPLS   1121 - 1190
KGSMEAGPYLPRALQQPLEQLTRYGRLLEELLREAGPELSSECRALGAAVQLLREQEARGRDLLAVEAVR   1191 - 1260
GCEIDLKEQGQLLHRDPFTVICGRKKCLRHVFLFEHLLLFSKLKGPEGGSEMFVYKQAFKTADMGLTENI   1261 - 1330
GDSGLCFELWFRRRRAREAYTLQATSPEIKLKWTSSIAQLLWRQAAHNKELRVQQMVSMGIGNKPFLDIK   1331 - 1400
ALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSPGACSLPARVEEEAWDLDVKQISLAPETLDSS   1401 - 1470
GDVSPGPRNSPSLQPPHPGSSTPTLASRGILGLSRQSHARALSDPTTPL                        1471 - 1519
//

Text Mined References (15)

PMID Year Title