Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.46
PubTator Score 15.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 3.36745080732927E-29
psoriasis 6685 2.10558248590673E-8
pediatric high grade glioma 2712 6.5050087177892E-7
malignant mesothelioma 3163 8.5883164488644E-7
lung adenocarcinoma 2714 1.42785624526685E-6
pilocytic astrocytoma 3086 2.2886354024963E-6
glioblastoma 5572 5.53395469260018E-6
medulloblastoma, large-cell 6234 2.17024432368627E-5
ovarian cancer 8492 2.32216339483027E-5
osteosarcoma 7933 7.95882620543597E-5
tuberculosis and treatment for 6 months 686 2.03807011175832E-4
atypical teratoid / rhabdoid tumor 4369 2.06877112929736E-4
astrocytoma 1493 2.65389865043676E-4
cystic fibrosis 1670 4.20755091395755E-4
dermatomyositis 967 7.98154467487556E-4
invasive ductal carcinoma 2950 9.36947475668386E-4
ductal carcinoma in situ 1745 0.00117461768344575
primitive neuroectodermal tumor 3031 0.00167764643290255
oligodendroglioma 2849 0.00362861894872092
lung cancer 4473 0.00442104559158367
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00465708381533789
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00956165418407629
group 3 medulloblastoma 2254 0.00991114785632743
non-inflammatory breast cancer 208 0.026726353738681
aldosterone-producing adenoma 664 0.0435804214253374
ependymoma 2514 0.0444925010029907
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q8TER5 A5PL07 Q9BWP5 Q9H7L6 Q9NTF9 Q9NW24
Symbols SOLO

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (1)

PMID Text
16143467 Solo mRNA is ubiquitously expressed but enriched in brain, and it undergoes extensive alternative splicing.

AA Sequence

MEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLAKVQQEACAQY      1 - 70
SGFLFFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLALKCLAPGGGRVQEVPVPNEA     71 - 140
CAYLFTPEWLQGINKDRPTGRLSTCLLSAPSGIQRLPWAELICPRFVHKEGLMVGHQPSTLPPELPSGPP    141 - 210
GLPSPPLPEEALGTRSPGDGHNAPVEGPEGEYVELLEVTLPVRGSPTDAEGSPGLSRVRTVPTRKGAGGK    211 - 280
GRHRRHRAWMHQKGLGPRGQDGARPPGEGSSTGASPESPPGAEAVPEAAVLEVSEPPAEAVGEASGSCPL    281 - 350
RPGELRGGGGGGQGAEGPPGTPRRTGKGNRRKKRAAGRGALSRGGDSAPLSPGDKEDASHQEALGNLPSP    351 - 420
SEHKLPECHLVKEEYEGSGKPESEPKELKTAGEKEPQLSEACGPTEEGAGERELEGPGLLCMAGHTGPEG    421 - 490
PLSDTPTPPLETVQEGKGDNIPEEALAVSVSDHPDVAWDLMASGFLILTGGVDQSGRALLTITPPCPPEE    491 - 560
PPPSRDTLNTTLHYLHSLLRPDLQTLGLSVLLDLRQAPPLPPALIPALSQLQDSGDPPLVQRLLILIHDD    561 - 630
LPTELCGFQGAEVLSENDLKRVAKPEELQWELGGHRDPSPSHWVEIHQEVVRLCRLCQGVLGSVRQAIEE    631 - 700
LEGAAEPEEEEAVGMPKPLQKVLADPRLTALQRDGGAILMRLRSTPSSKLEGQGPATLYQEVDEAIHQLV    701 - 770
RLSNLHVQQQEQRQCLRRLQQVLQWLSGPGEEQLASFAMPGDTLSALQETELRFRAFSAEVQERLAQARE    771 - 840
ALALEENATSQKVLDIFEQRLEQVESGLHRALRLQRFFQQAHEWVDEGFARLAGAGPGREAVLAALALRR    841 - 910
APEPSAGTFQEMRALALDLGSPAALREWGRCQARCQELERRIQQHVGEEASPRGYRRRRADGASSGGAQW    911 - 980
GPRSPSPSLSSLLLPSSPGPRPAPSHCSLAPCGEDYEEEGPELAPEAEGRPPRAVLIRGLEVTSTEVVDR    981 - 1050
TCSPREHVLLGRARGPDGPWGVGTPRMERKRSISAQQRLVSELIACEQDYVATLSEPVPPPGPELTPELR   1051 - 1120
GTWAAALSARERLRSFHRTHFLRELQGCATHPLRIGACFLRHGDQFSLYAQYVKHRHKLENGLAALSPLS   1121 - 1190
KGSMEAGPYLPRALQQPLEQLTRYGRLLEELLREAGPELSSECRALGAAVQLLREQEARGRDLLAVEAVR   1191 - 1260
GCEIDLKEQGQLLHRDPFTVICGRKKCLRHVFLFEHLLLFSKLKGPEGGSEMFVYKQAFKTADMGLTENI   1261 - 1330
GDSGLCFELWFRRRRAREAYTLQATSPEIKLKWTSSIAQLLWRQAAHNKELRVQQMVSMGIGNKPFLDIK   1331 - 1400
ALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSPGACSLPARVEEEAWDLDVKQISLAPETLDSS   1401 - 1470
GDVSPGPRNSPSLQPPHPGSSTPTLASRGILGLSRQSHARALSDPTTPL                        1471 - 1519
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16143467 2005 Identification, expression analysis, genomic organization and cellular location of a novel protein with a RhoGEF domain.
More...