Property Summary

NCBI Gene PubMed Count 12
Grant Count 5
R01 Count 5
Funding $285,722.66
PubMed Score 4.53
PubTator Score 3.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.185 0.000
pancreatic ductal adenocarcinoma liver m... -1.318 0.017
dermatomyositis -1.100 0.001

Gene RIF (3)

PMID Text
22190034 HIV-1 Vpr is identified to have a physical interaction with DDB1 and CUL4 associated factor 11 (DCAF11; WDR23) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 Vpr is identified to have a physical interaction with DDB1 and CUL4 associated factor 11 (DCAF11; WDR23) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19273594 Includes the functional characterization of a similar protein in C. elegans and comparison to the human protein.

AA Sequence

MGSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLRRGQVRLVQGGGAANLQFIQ      1 - 70
ALLDSEEENDRAWDGRLGDRYNPPVDATPDTRELEFNEIKTQVELATGQLGLRRAAQKHSFPRMLHQRER     71 - 140
GLCHRGSFSLGEQSRVISHFLPNDLGFTDSYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFRKFK    141 - 210
SIKARDVGWSVLDVAFTPDGNHFLYSSWSDYIHICNIYGEGDTHTALDLRPDERRFAVFSIAVSSDGREV    211 - 280
LGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTMREDDPKPVGA    281 - 350
LAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDYRWQQVPKKAWRKL    351 - 420
KLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVS    421 - 490
WHPFEEKIVSSSWDGNLRLWQYRQAEYFQDDMPESEECASAPAPVPQSSTPFSSPQ                  491 - 546
//

Text Mined References (16)

PMID Year Title
27254819 2016 DDB1 and CUL4 associated factor 11 (DCAF11) mediates degradation of Stem-loop binding protein at the end of S phase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190034 2011 Global landscape of HIV-human protein complexes.
19295130 2009 An interaction network of the mammalian COP9 signalosome identifies Dda1 as a core subunit of multiple Cul4-based E3 ligases.
19273594 2009 The WD40 repeat protein WDR-23 functions with the CUL4/DDB1 ubiquitin ligase to regulate nuclear abundance and activity of SKN-1 in Caenorhabditis elegans.
19109893 2008 Structural basis of UV DNA-damage recognition by the DDB1-DDB2 complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16964240 2006 Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
More...