Property Summary

NCBI Gene PubMed Count 5
PubMed Score 98.39
PubTator Score 3.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 2.1e-04
ependymoma 1.300 3.1e-05
glioblastoma 1.200 1.2e-04
group 3 medulloblastoma 1.100 2.8e-02
non-small cell lung cancer 1.260 5.1e-15
ovarian cancer -1.300 4.5e-04
pediatric high grade glioma 1.200 4.3e-03
primitive neuroectodermal tumor 1.300 2.0e-02
type II diabetes mellitus and post-ische... -1.100 2.3e-02

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MLFRNRFLLLLALAALLAFVSLSLQFFHLIPVSTPKNGMSSKSRKRIMPDPVTEPPVTDPVYEALLYCNI      1 - 70
PSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVANRKPYHPKLEAFISHMSKGS     71 - 140
GASFESPLNSLPLYPNHPLCEMGELTQTGVVQHLQNGQLLRDIYLKKHKLLPNDWSADQLYLETTGKSRT    141 - 210
LQSGLALLYGFLPDFDWKKIYFRHQPSALFCSGSCYCPVRNQYLEKEQRRQYLLRLKNSQLEKTYGEMAK    211 - 280
IVDVPTKQLRAANPIDSMLCHFCHNVSFPCTRNGCVDMEHFKVIKTHQIEDERERREKKLYFGYSLLGAH    281 - 350
PILNQTIGRMQRATEGRKEELFALYSAHDVTLSPVLSALGLSEARFPRFAARLIFELWQDREKPSEHSVR    351 - 420
ILYNGVDVTFHTSFCQDHHKRSPKPMCPLENLVRFVKRDMFVALGGSGTNYYDACHREGF              421 - 480
//

Text Mined References (7)

PMID Year Title