Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.41
PubTator Score 10.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TE69 A8K784 B7Z6H6 B7ZL96 D6RA72 E7ENU3 Q2M3E9
Symbols EOLA1
CXorf40
FLJ16423

Gene

 Compartment GO Term (0)

Gene RIF (5)

PMID Text
24916366 Data shows that EOLA1 in HUVEC dramatically decreased inflammation factor IL-6 production and apoptosis induced by LPS treatment.
21223654 EOLA1 protein is localized in the nucleus and the matrix of ECV304 cells, and it plays a role as a signal transduction factor.
17557240 effect of inhibiting the expression of endothelial-overexpressed lipopolysaccharide-associated factor 1 (EOLA1) on proliferation of human umbilical vein endothelial cell line ECV304
16215939 Findings suggest that EOLA1 is a novel gene and the interaction of EOLA1 and MT2A may play an important role in cell protection in inflammation reaction.
15541360 EOLA1 and MT2A may have an important role of cell protection in inflammation reaction.

AA Sequence

MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVERLGMTPAQIQT      1 - 70
LLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGK     71 - 140
DVFQVDIPEHLIPLGHEV                                                        141 - 158
//

Text Mined References (14)

PMID Year Title
24916366 2014 EOLA1 protects lipopolysaccharide induced IL-6 production and apoptosis by regulation of MT2A in human umbilical vein endothelial cells.
21223654 2010 [Subcellular localization of human endothelial-overexpressed lipopolysaccharide-associated factor 1 protein].
17557240 2007 [The effect of inhibiting EOLA1 expression in ECV304 cells].
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16383041 2005 [Purification of human endothelial overexpressed lipopolysaccharide-associated factor 1 protein].
16215939 2005 [Identification and characterization of a novel gene EOLA1 stimulating ECV304 cell proliferation].
15772651 2005 The DNA sequence of the human X chromosome.
15541360 2004 Identification and characterization of a novel gene EOLA1 stimulating ECV304 cell proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...