Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.41
PubTator Score 10.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVERLGMTPAQIQT      1 - 70
LLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGK     71 - 140
DVFQVDIPEHLIPLGHEV                                                        141 - 158
//

Text Mined References (14)

PMID Year Title