Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.52
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
interstitial cystitis -1.300 0.002

Gene RIF (5)

PMID Text
25051287 We found that the AAAAA, AGGAG, and AGGGA haplotypes in ACVR2B were associated with susceptibility to Premature Ovarian Failure when they also had at least one CATAG haplotype in ADAMTS19.
24014609 Synergistic interactions were detected between SNPs, including a non-synonymous SNP, and diplotypes within IGF2R and ADAMTS19 which may contribute to POF.
23333304 HIV-1 Vif downregulates the expression of ADAM metallopeptidase with thrombospondin type 1 motif 19 protein (ADAMTS19) in Vif-expression T cells
19508998 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19508998 Although limited by sample size, this proof-of-principle study's findings reveal ADAMTS19 as a possible candidate gene for premature ovarian failure and thus a larger follow-up study is warranted.

AA Sequence

MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDPAGGSGGSADPGWVRGVGGGG      1 - 70
SARAQAAGSSREVRSVAPVPLEEPVEGRSESRLRPPPPSEGEEDEELESQELPRGSSGAAALSPGAPASW     71 - 140
QPPPPPQPPPSPPPAQHAEPDGDEVLLRIPAFSRDLYLLLRRDGRFLAPRFAVEQRPNPGPGPTGAASAP    141 - 210
QPPAPPDAGCFYTGAVLRHPGSLASFSTCGGGLMGFIQLNEDFIFIEPLNDTMAITGHPHRVYRQKRSME    211 - 280
EKVTEKSALHSHYCGIISDKGRPRSRKIAESGRGKRYSYKLPQEYNIETVVVADPAMVSYHGADAARRFI    281 - 350
LTILNMVFNLFQHKSLSVQVNLRVIKLILLHETPPELYIGHHGEKMLESFCKWQHEEFGKKNDIHLEMST    351 - 420
NWGEDMTSVDAAILITRKDFCVHKDEPCDTVGIAYLSGMCSEKRKCIIAEDNGLNLAFTIAHEMGHNMGI    421 - 490
NHDNDHPSCADGLHIMSGEWIKGQNLGDVSWSRCSKEDLERFLRSKASNCLLQTNPQSVNSVMVPSKLPG    491 - 560
MTYTADEQCQILFGPLASFCQEMQHVICTGLWCKVEGEKECRTKLDPPMDGTDCDLGKWCKAGECTSRTS    561 - 630
APEHLAGEWSLWSPCSRTCSAGISSRERKCPGLDSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAY    631 - 700
SVRTSSPKHILQWQAVLDEEKPCALFCSPVGKEQPILLSEKVMDGTSCGYQGLDICANGRCQKVGCDGLL    701 - 770
GSLAREDHCGVCNGNGKSCKIIKGDFNHTRGAGYVEVLVIPAGARRIKVVEEKPAHSYLALRDAGKQSIN    771 - 840
SDWKIEHSGAFNLAGTTVHYVRRGLWEKISAKGPTTAPLHLLVLLFQDQNYGLHYEYTIPSDPLPENQSS    841 - 910
KAPEPLFMWTHTSWEDCDATCGGGERKTTVSCTKIMSKNISIVDNEKCKYLTKPEPQIRKCNEQPCQTRW    911 - 980
MMTEWTPCSRTCGKGMQSRQVACTQQLSNGTLIRARERDCIGPKPASAQRCEGQDCMTVWEAGVWSECSV    981 - 1050
KCGKGIRHRTVRCTNPRKKCVLSTRPREAEDCEDYSKCYVWRMGDWSKCSITCGKGMQSRVIQCMHKITG   1051 - 1120
RHGNECFSSEKPAAYRPCHLQPCNEKINVNTITSPRLAALTFKCLGDQWPVYCRVIREKNLCQDMRWYQR   1121 - 1190
CCETCRDFYAQKLQQKS                                                        1191 - 1207
//

Text Mined References (9)

PMID Year Title
25051287 2015 Epistasis between polymorphisms in ACVR2B and ADAMTS19 is associated with premature ovarian failure.
24014609 2013 Epistasis between IGF2R and ADAMTS19 polymorphisms associates with premature ovarian failure.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22445761 2012 Genome-wide association study of SSRI/SNRI-induced sexual dysfunction in a Japanese cohort with major depression.
19508998 2009 Genome-wide association study in premature ovarian failure patients suggests ADAMTS19 as a possible candidate gene.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
11867212 2002 Cloning, expression analysis, and structural characterization of seven novel human ADAMTSs, a family of metalloproteinases with disintegrin and thrombospondin-1 domains.