Property Summary

NCBI Gene PubMed Count 16
PubMed Score 69.18
PubTator Score 13.27

Knowledge Summary

Patent (6,202)




Accession Q8TE04 A6NIP0 Q7RTX6 Q7Z495 Q8TBQ8 hPanK
Symbols PANK


PANTHER Protein Class (2)


2I7N   3SMP  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 GWAS Trait (1)

Gene RIF (11)

25505242 The interaction of HIV-1 CA with human cellular pantothenate kinase 1 protein (PANK1) is identified by yeast two-hybrid screen
23343762 p53 plays an important role in regulating energy homeostasis through transcriptional control of PANK1.
22912811 PANK deficiency leads to abnormalities in F-actin organization.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19060910 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of pantothenate kinase 1 (PANK1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17631502 analysis of the homodimeric structures of the catalytic cores of PanK1alpha and PanK3 in complex with acetyl-CoA and the the structural effects of the PanK2 mutations that have been implicated in neurodegeneration
16385451 Observational study of gene-disease association. (HuGE Navigator)
14523052 PPARalpha transcription factor as a major factor governing hepatic CoA levels by specific modulation of PANK1alpha gene expression
12379284 alternative splicing product

AA Sequence

YAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK                                    561 - 598

Text Mined References (17)

PMID Year Title
23343762 2013 p53-Dependent regulation of metabolic function through transcriptional activation of pantothenate kinase-1 gene.
22912811 2012 Cofilin/Twinstar phosphorylation levels increase in response to impaired coenzyme a metabolism.
20833636 2011 p53 activates the PANK1/miRNA-107 gene leading to downregulation of CDK6 and p130 cell cycle proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17631502 2007 Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).