Property Summary

NCBI Gene PubMed Count 16
Grant Count 35
R01 Count 22
Funding $6,319,009.54
PubMed Score 69.18
PubTator Score 13.27

Knowledge Summary

Patent (6,202)

Expression

 GWAS Trait (1)

Gene RIF (11)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular pantothenate kinase 1 protein (PANK1) is identified by yeast two-hybrid screen
23343762 p53 plays an important role in regulating energy homeostasis through transcriptional control of PANK1.
22912811 PANK deficiency leads to abnormalities in F-actin organization.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19060910 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of pantothenate kinase 1 (PANK1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17631502 analysis of the homodimeric structures of the catalytic cores of PanK1alpha and PanK3 in complex with acetyl-CoA and the the structural effects of the PanK2 mutations that have been implicated in neurodegeneration
16385451 Observational study of gene-disease association. (HuGE Navigator)
14523052 PPARalpha transcription factor as a major factor governing hepatic CoA levels by specific modulation of PANK1alpha gene expression
12379284 alternative splicing product
More...

AA Sequence

MLKLVGGGGGQDWACSVAGTSLGGEEAAFEVARPGDQGKAGGGSPGWGCAGIPDSAPGAGVLQAGAVGPA      1 - 70
RGGQGAEEVGESAGGGEERRVRHPQAPALRLLNRKPQGGSGEIKTPENDLQRGRLSRGPRTAPPAPGMGD     71 - 140
RSGQQERSVPHSPGAPVGTSAAAVNGLLHNGFHPPPVQPPHVCSRGPVGGSDAAPQRLPLLPELQPQPLL    141 - 210
PQHDSPAKKCRLRRRMDSGRKNRPPFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSN    211 - 280
TAYGKTGIRDVHLELKNLTMCGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDF    281 - 350
RMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVS    351 - 420
ILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQG    421 - 490
SAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLA    491 - 560
YAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK                                    561 - 598
//

Text Mined References (17)

PMID Year Title
23343762 2013 p53-Dependent regulation of metabolic function through transcriptional activation of pantothenate kinase-1 gene.
22912811 2012 Cofilin/Twinstar phosphorylation levels increase in response to impaired coenzyme a metabolism.
20833636 2011 p53 activates the PANK1/miRNA-107 gene leading to downregulation of CDK6 and p130 cell cycle proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17631502 2007 Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...