Property Summary

NCBI Gene PubMed Count 16
PubMed Score 56.95
PubTator Score 13.27

Knowledge Summary

Patent (6,202)

Expression

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MLKLVGGGGGQDWACSVAGTSLGGEEAAFEVARPGDQGKAGGGSPGWGCAGIPDSAPGAGVLQAGAVGPA      1 - 70
RGGQGAEEVGESAGGGEERRVRHPQAPALRLLNRKPQGGSGEIKTPENDLQRGRLSRGPRTAPPAPGMGD     71 - 140
RSGQQERSVPHSPGAPVGTSAAAVNGLLHNGFHPPPVQPPHVCSRGPVGGSDAAPQRLPLLPELQPQPLL    141 - 210
PQHDSPAKKCRLRRRMDSGRKNRPPFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSN    211 - 280
TAYGKTGIRDVHLELKNLTMCGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDF    281 - 350
RMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVS    351 - 420
ILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQG    421 - 490
SAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLA    491 - 560
YAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK                                    561 - 598
//

Text Mined References (17)

PMID Year Title