Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.63
PubTator Score 3.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.100 0.002
osteosarcoma -1.501 0.000
tuberculosis 1.400 0.000
subependymal giant cell astrocytoma 1.367 0.026

Gene RIF (3)

PMID Text
24986920 RNase H2 complex is assembled in the cytosol and imported into the nucleus in an RNase H2B-dependent manner.
19015152 Examination of the effect of several Aicardi-Goutieres Syndrome-related mutations in the C subunit of RNase H2.
8244390 Describes an RNASEH2C pseudogene that is located close to the SRY gene on chromosome Y.

AA Sequence

MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRG      1 - 70
EEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGP     71 - 140
DAKVRGALTWPSLAAAIHAQVPED                                                  141 - 164
//

Text Mined References (17)

PMID Year Title
24986920 2014 Altered spatio-temporal dynamics of RNase H2 complex assembly at replication and repair sites in Aicardi-Goutières syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21177858 2011 The structural and biochemical characterization of human RNase H2 complex reveals the molecular basis for substrate recognition and Aicardi-Goutières syndrome defects.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20131292 2010 Expanding the phenotypic spectrum of lupus erythematosus in Aicardi-Goutières syndrome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19015152 2009 Contributions of the two accessory subunits, RNASEH2B and RNASEH2C, to the activity and properties of the human RNase H2 complex.
More...