Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.33
PubTator Score 3.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
AICARDI-GOUTIERES SYNDROME 3 1 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 7.4e-07
oligodendroglioma 2850 1.7e-03
osteosarcoma 7950 3.3e-03
subependymal giant cell astrocytoma 2287 2.6e-02
Disease Target Count Z-score Confidence
Atopic dermatitis 952 0.0 1.9
Kidney disease 430 0.0 3.0
Disease Target Count
Aicardi-Goutieres syndrome 19

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.100 1.7e-03
osteosarcoma -1.344 3.3e-03
subependymal giant cell astrocytoma 1.367 2.6e-02
tuberculosis 1.400 7.4e-07

 GWAS Trait (1)

Pathway (1)

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRG      1 - 70
EEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGP     71 - 140
DAKVRGALTWPSLAAAIHAQVPED                                                  141 - 164
//

Text Mined References (18)

PMID Year Title