Property Summary

NCBI Gene PubMed Count 16
PubMed Score 23.46
PubTator Score 9.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 4.7e-07
Breast cancer 3.200 2.5e-02
group 3 medulloblastoma 1.200 7.1e-04
hepatocellular carcinoma 1.400 3.0e-05
osteosarcoma -1.481 3.5e-06
pancreatic cancer 1.200 7.4e-03
pancreatic carcinoma 1.200 7.4e-03
primitive neuroectodermal tumor 1.400 7.6e-05
tuberculosis -1.800 5.9e-06

Gene RIF (2)

AA Sequence

MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGL      1 - 70
REMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQ     71 - 140
HMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF                           141 - 187
//

Text Mined References (20)

PMID Year Title