Property Summary

NCBI Gene PubMed Count 16
Grant Count 2
Funding $69,308.58
PubMed Score 21.37
PubTator Score 9.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q8TDH9 B4DVM2 Q0VDJ6 Q0VDJ7 Q5THS1 Q68D56 Q8N5F9 Q9NU16 BLOC-1 subunit 5
Symbols MU
BLOS5
MUTED

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
21044367 Observational study of gene-disease association. (HuGE Navigator)
17618940 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGL      1 - 70
REMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQ     71 - 140
HMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF                           141 - 187
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22203680 2012 Assembly and architecture of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
21269460 2011 Initial characterization of the human central proteome.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17618940 2008 Dysbindin (DTNBP1) and the biogenesis of lysosome-related organelles complex 1 (BLOC-1): main and epistatic gene effects are potential contributors to schizophrenia susceptibility.
17182842 2007 BLOC-1 is required for cargo-specific sorting from vacuolar early endosomes toward lysosome-related organelles.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...