Property Summary

NCBI Gene PubMed Count 12
Grant Count 11
R01 Count 5
Funding $687,850.25
PubMed Score 9.60
PubTator Score 9.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.860 0.000
mucosa-associated lymphoid tissue lympho... 1.073 0.016

 GWAS Trait (1)

Gene RIF (9)

PMID Text
25330932 Ras guanine nucleotide-releasing protein 4 is aberrantly expressed in the fibroblast-like synoviocytes of patients with rheumatoid arthritis and controls their proliferation.
22728827 GPCR activation of Ras and PI3Kc in neutrophils depends on PLCb2/b3 and the RasGEF RasGRP4.
21933395 Identification of defective isoforms of hRasGRP4 transcripts in rheumatoid arthritis(RA) patients raises the possibility that dysregulated expression of hRasGRP4 in developing monocytes plays a pathogenic role in this subset of RA patients.
19350351 RasGRP4 cooperates with AML1 mutations in T cell leukemogenesis as a class I mutation
18024961 RasGRP4 translocates to varied intracellular compartments via its DAG/PMA-binding domain to regulate signaling pathways that control gene and protein expression in MCs, including the cell's ability to respond to IL-13.
12493770 RasGRP4 regulates the expression of prostaglandin D2 in mast cells
11956218 identification of defective variants of this signaling protein in asthma, mastocytosis, and mast cell leukemia patients and demonstration of the importance of RasGRP4 in mast cell development and function
11956218 RasGRP4 is a cation-dependent, guanine nucleotide exchange factor and diacylglycerol/phorbol ester receptor that is selectively expressed in mast cells and their progenitors. RasGRP4 regulates the final stages of mast cell development.
11880369 RasGRP4 plays a role in myeloid cell signaling growth regulation pathways that are responsive to diacylglycerol levels

AA Sequence

MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDELLEKCIQSFD      1 - 70
SAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQICHLVRYWLMRHPEVMHQDP     71 - 140
QLEEVIGRFWATVAREGNSAQRRLGDSSDLLSPGGPGPPLPMSSPGLGKKRKVSLLFDHLETGELAQHLT    141 - 210
YLEFRSFQAITPQDLRSYVLQGSVRGCPALEGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQR    211 - 280
LHQLQNFNTLMAVTGGLCHSAISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLPV    281 - 350
LGVHLKDLVSLHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTED    351 - 420
EIYELSYAREPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDPEGRGTISQED    421 - 490
FERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFLHTFHEVTFRKPTFCDSCSGF    491 - 560
LWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVPSTPAPHASCGSEENHSYTLSLE    561 - 630
PETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASSKLDS                               631 - 673
//

Text Mined References (16)

PMID Year Title
25330932 2015 Ras guanine nucleotide-releasing protein 4 is aberrantly expressed in the fibroblast-like synoviocytes of patients with rheumatoid arthritis and controls their proliferation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22728827 2012 GPCR activation of Ras and PI3Kc in neutrophils depends on PLCb2/b3 and the RasGEF RasGRP4.
21933395 2011 Aberrant splicing of the hRasGRP4 transcript and decreased levels of this signaling protein in the peripheral blood mononuclear cells in a subset of patients with rheumatoid arthritis.
21182207 2010 Variants in several genomic regions associated with asperger disorder.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19350351 2009 Possible involvement of RasGRP4 in leukemogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18024961 2008 The Diacylglycerol-dependent translocation of ras guanine nucleotide-releasing protein 4 inside a human mast cell line results in substantial phenotypic changes, including expression of interleukin 13 receptor alpha2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...