Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.35
PubTator Score 9.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.2e-06
mucosa-associated lymphoid tissue lymphoma 484 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 1.0

Expression

  Differential Expression (2)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.073 1.6e-02
osteosarcoma -2.860 2.2e-06

Protein-protein Interaction (3)

Gene RIF (9)

AA Sequence

MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDELLEKCIQSFD      1 - 70
SAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQICHLVRYWLMRHPEVMHQDP     71 - 140
QLEEVIGRFWATVAREGNSAQRRLGDSSDLLSPGGPGPPLPMSSPGLGKKRKVSLLFDHLETGELAQHLT    141 - 210
YLEFRSFQAITPQDLRSYVLQGSVRGCPALEGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQR    211 - 280
LHQLQNFNTLMAVTGGLCHSAISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLPV    281 - 350
LGVHLKDLVSLHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTED    351 - 420
EIYELSYAREPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDPEGRGTISQED    421 - 490
FERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFLHTFHEVTFRKPTFCDSCSGF    491 - 560
LWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVPSTPAPHASCGSEENHSYTLSLE    561 - 630
PETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASSKLDS                               631 - 673
//

Text Mined References (16)

PMID Year Title