Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.19
PubTator Score 10.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
glioblastoma multiforme 347 4.6835185158304E-18
psoriasis 6685 1.0677794670362E-15
atypical teratoid / rhabdoid tumor 4369 8.88059490778107E-5
medulloblastoma 1524 1.36907385448908E-4
Pick disease 1893 0.00142442756804499
cystic fibrosis 1670 0.00296145590720445
oligodendroglioma 2849 0.00592980537197141
ependymoma 2514 0.0089208945043426
primitive neuroectodermal tumor 3031 0.0102199028950992
astrocytic glioma 2241 0.01230877337323
medulloblastoma, large-cell 6234 0.0149101546614802
adult high grade glioma 2148 0.0262719169238473
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Carnitine palmitoyltransferase II deficiency 16 3.505 1.8

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.100 0.012
ependymoma -1.500 0.009
oligodendroglioma -1.100 0.006
glioblastoma multiforme -1.200 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.500 0.015
primitive neuroectodermal tumor -1.200 0.010
cystic fibrosis 1.300 0.003
adult high grade glioma -1.200 0.026
Pick disease -1.100 0.001
psoriasis -1.600 0.000

Synonym

Accession Q8TDF5 Q86W85 Q8ND78 Q8TDF4
Symbols BCTL1
BTCL1

Gene

  Ortholog (12)

Gene RIF (6)

PMID Text
26277340 Results suggested that the extracellular N-terminal region including the two CUB domains was largely responsible for the distinct regulatory effects of Neto1 and Neto2 on the desensitization properties of GluK1 homomeric receptors
23621516 Neto1 is concluded to be a component of amyloid precursor protein /NMDA receptor trafficking complexes
22205981 no evidence for the association of NETO1 with schizophrenia in the Japanese population
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19243221 Mouse neto1 plays a critical role in spatial learning and memory through the regulation of NMDAR subunit abundance at synapses.

AA Sequence

MIHGRSVLHIVASLIILHLSGATKKGTEKQTTSETQKSVQCGTWTKHAEGGIFTSPNYPSKYPPDRECIY      1 - 70
IIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQQNPPVIKSSGRFLWIKFFAD     71 - 140
GELESMGFSARYNFTPDPDFKDLGALKPLPACEFEMGGSEGIVESIQIMKEGKATASEAVDCKWYIRAPP    141 - 210
RSKIYLRFLDYEMQNSNECKRNFVAVYDGSSSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRF    211 - 280
QMLFTSFQEPPCEGNTFFCHSNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTS    281 - 350
CIVIILIIISVIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVADDFENYHKL    351 - 420
RRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASILTEMPTQPGKPLIPPMNRRNILVMKHSYSQDAADAC    421 - 490
DIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV                               491 - 533
//

Text Mined References (17)

PMID Year Title
26277340 2015 The auxiliary subunits Neto1 and Neto2 have distinct, subunit-dependent effects at recombinant GluK1- and GluK2-containing kainate receptors.
24315451 2014 Fraction of exhaled nitric oxide values in childhood are associated with 17q11.2-q12 and 17q12-q21 variants.
23621516 2013 Neto1 associates with the NMDA receptor/amyloid precursor protein complex.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
22566634 2012 The genetic architecture of economic and political preferences.
22205981 2011 A case control association study and cognitive function analysis of neuropilin and tolloid-like 1 gene and schizophrenia in the Japanese population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20499253 2010 Genetic determinants of autism in individuals with deletions of 18q.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19243221 2009 Neto1 is a novel CUB-domain NMDA receptor-interacting protein required for synaptic plasticity and learning.
More...