Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.31
PubTator Score 3.63

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
Amyotrophic Lateral Sclerosis 432 2.25875594832437E-7
ovarian cancer 8492 4.89734030298872E-7
non primary Sjogren syndrome sicca 840 0.0207175317598385
spina bifida 1064 0.0409323319619009
Disease Target Count Z-score Confidence
Colorectal adenocarcinoma 6 3.048 1.5


  Differential Expression (4)

Disease log2 FC p
Amyotrophic Lateral Sclerosis -1.173 0.000
non primary Sjogren syndrome sicca 1.200 0.021
spina bifida 1.171 0.041
ovarian cancer -1.200 0.000


Accession Q8TDD1 Q86YT8 Q9BRZ1
Symbols DP97


  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

23239230 Ddx54 plays an important role in central nervous system myelination, presumably in myelin sheath formation after the differentiation of oligodendrocytes.
22910411 DP97 was found to be a gene (or promoter)-selective co-activator for hCAR
17081983 Includes the identification of DEAD box polypeptide 54 phosphopeptides following the stimulation of HeLa cells with epidermal growth factor.
16260042 Identifies dead box polypeptide 54 as a 14-3-3-binding protein.
15635413 Kinetic analysis of DEAD box helicases, including DEAD box polypeptide 54, in response to transcription inhibition.
12429849 Identifies DEAD box polypeptide 54 (similar to RIKEN cDNA 2410015A15 gene) as one of 213 different nucleolar proteins in HeLa cells.
11790298 Identifies DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 (locus 79039) as a novel nucleolar protein in HeLa cells.

AA Sequence

FLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM                                 841 - 881

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23239230 2013 A DEAD-box RNA helicase Ddx54 protein in oligodendrocytes is indispensable for myelination in the central nervous system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22910411 2012 DP97, a DEAD box DNA/RNA helicase, is a target gene-selective co-regulator of the constitutive androstane receptor.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.