Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.48
PubTator Score 3.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
Amyotrophic lateral sclerosis 451 2.3e-07
ovarian cancer 8520 4.9e-07
non primary Sjogren syndrome sicca 891 2.1e-02
spina bifida 1074 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Colorectal adenocarcinoma 5 3.037 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
Amyotrophic lateral sclerosis -1.173 2.3e-07
non primary Sjogren syndrome sicca 1.200 2.1e-02
ovarian cancer -1.200 4.9e-07
spina bifida 1.171 4.1e-02

Gene RIF (7)

AA Sequence

MAADKGPAAGPRSRAAMAQWRKKKGLRKRRGAASQARGSDSEDGEFEIQAEDDARARKLGPGRPLPTFPT      1 - 70
SECTSDVEPDTREMVRAQNKKKKKSGGFQSMGLSYPVFKGIMKKGYKVPTPIQRKTIPVILDGKDVVAMA     71 - 140
RTGSGKTACFLLPMFERLKTHSAQTGARALILSPTRELALQTLKFTKELGKFTGLKTALILGGDRMEDQF    141 - 210
AALHENPDIIIATPGRLVHVAVEMSLKLQSVEYVVFDEADRLFEMGFAEQLQEIIARLPGGHQTVLFSAT    211 - 280
LPKLLVEFARAGLTEPVLIRLDVDTKLNEQLKTSFFLVREDTKAAVLLHLLHNVVRPQDQTVVFVATKHH    281 - 350
AEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVTDLAARGLDIPLLDNVINYSFPAKGK    351 - 420
LFLHRVGRVARAGRSGTAYSLVAPDEIPYLLDLHLFLGRSLTLARPLKEPSGVAGVDGMLGRVPQSVVDE    421 - 490
EDSGLQSTLEASLELRGLARVADNAQQQYVRSRPAPSPESIKRAKEMDLVGLGLHPLFSSRFEEEELQRL    491 - 560
RLVDSIKNYRSRATIFEINASSRDLCSQVMRAKRQKDRKAIARFQQGQQGRQEQQEGPVGPAPSRPALQE    561 - 630
KQPEKEEEEEAGESVEDIFSEVVGRKRQRSGPNRGAKRRREEARQRDQEFYIPYRPKDFDSERGLSISGE    631 - 700
GGAFEQQAAGAVLDLMGDEAQNLTRGRQQLKWDRKKKRFVGQSGQEDKKKIKTESGRYISSSYKRDLYQK    701 - 770
WKQKQKIDDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLH    771 - 840
FLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM                                 841 - 881
//

Text Mined References (23)

PMID Year Title