Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $110,614
PubMed Score 26.84
PubTator Score 17.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis -1.171 0.000
medulloblastoma -1.200 0.025
pilocytic astrocytoma 1.100 0.018
Breast cancer -1.500 0.000
invasive ductal carcinoma -1.200 0.004
ovarian cancer -6.100 0.000
pituitary cancer 2.600 0.000

Synonym

Accession Q8TDB4 Q9BZC3
Symbols OSAP
HUMMR
CESP-1
C4orf49

Gene

 Grant Application (1)

Gene RIF (5)

PMID Text
23209644 The present study identified a proximal core sequence in the MGARP promoter that is composed of two enriched Sp1 binding motifs and established Sp1 as one major MGARP transactivator.
20107910 Results identify a mitochondria-localized glutamic acid-rich protein (MGARP/OSAP) as one of the highly expressed proteins in retina.
20107910 Results identify a mitochondria-localized glutamic acid-rich protein (MGARP/OSAP) as one of the highly expressed proteins in retina [MGARP].
19528298 Results identify a novel mitochondria protein, hypoxia up-regulated mitochondrial movement regulator (HUMMR), which is expressed in neurons and is markedly induced by hypoxia-inducible factor 1 alpha (HIF-1alpha).
19325000 OSAP is prominently expressed in steroidogenic tissues; results suggest that OSAP is involved in steroidogenesis, potentially through its ability to maintain mitochondrial abundance and morphology

AA Sequence

MYLRRAVSKTLALPLRAPPNPAPLGKDASLRRMSSNRFPGSSGSNMIYYLVVGVTVSAGGYYAYKTVTSD      1 - 70
QAKHTEHKTNLKEKTKAEIHPFQGEKENVAETEKASSEAPEELIVEAEVVDAEESPSATVVVIKEASACP     71 - 140
GHVEAAPETTAVSAETGPEVTDAAARETTEVNPETTPEVTNAALDEAVTIDNDKDTTKNETSDEYAELEE    141 - 210
ENSPAESESSAGDDLQEEASVGSEAASAQG                                            211 - 240
//

Text Mined References (12)

PMID Year Title
23209644 2012 Mitochondria-localized glutamic acid-rich protein (MGARP) gene transcription is regulated by Sp1.
21447634 2011 The expression of a mitochondria-localized glutamic acid-rich protein (MGARP/OSAP) is under the regulation of the HPG axis.
21269460 2011 Initial characterization of the human central proteome.
20107910 2011 A mitochondria-localized glutamic acid-rich protein (MGARP/OSAP) is highly expressed in retina that exhibits a large area of intrinsic disorder.
20016276 2010 During hypoxia, HUMMR joins the mitochondrial dance.
19528298 2009 HUMMR, a hypoxia- and HIF-1alpha-inducible protein, alters mitochondrial distribution and transport.
19325000 2009 Expression of ovary-specific acidic protein in steroidogenic tissues: a possible role in steroidogenesis.
16565373 2006 Distribution of CESP-1 protein in the corneal endothelium and other tissues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12770732 2003 The generation and characterization of an ovary-selective cDNA library.
More...