Property Summary

NCBI Gene PubMed Count 9
PubMed Score 28.43
PubTator Score 17.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count
Rheumatoid arthritis 1191

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.6e-02
Breast cancer -1.500 2.0e-42
cystic fibrosis -1.171 6.9e-05
group 4 medulloblastoma -1.200 2.3e-02
invasive ductal carcinoma -1.200 4.2e-03
ovarian cancer -6.100 1.6e-23
pituitary cancer 2.600 3.4e-06

Gene RIF (5)

AA Sequence

MYLRRAVSKTLALPLRAPPNPAPLGKDASLRRMSSNRFPGSSGSNMIYYLVVGVTVSAGGYYAYKTVTSD      1 - 70
QAKHTEHKTNLKEKTKAEIHPFQGEKENVAETEKASSEAPEELIVEAEVVDAEESPSATVVVIKEASACP     71 - 140
GHVEAAPETTAVSAETGPEVTDAAARETTEVNPETTPEVTNAALDEAVTIDNDKDTTKNETSDEYAELEE    141 - 210
ENSPAESESSAGDDLQEEASVGSEAASAQG                                            211 - 240
//

Text Mined References (12)

PMID Year Title