Property Summary

NCBI Gene PubMed Count 5
PubMed Score 32.84
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 4 medulloblastoma 1875 2.3e-08
osteosarcoma 7933 2.4e-08
psoriasis 6685 2.7e-06
lung cancer 4473 1.1e-04
spina bifida 1064 1.7e-02

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -4.000 2.7e-06
osteosarcoma -3.076 2.4e-08
group 4 medulloblastoma 1.900 2.3e-08
lung cancer 2.200 1.1e-04
spina bifida -1.063 1.7e-02

Gene RIF (1)

PMID Text
11751921 the novel zinc finger protein TIZ may play a role during osteoclast differentiation by modulating TRAF6 signaling activity.

AA Sequence

MGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPLTVKRHEM      1 - 70
VNEPPVMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVDECKLHKGGYNGLNQCLPTMQ     71 - 140
SKMFQCDKYVKVFNKFSHSDRHKIKHMENKPFKCKECGRSFCMLSHLTRHERNYTKVNFCKCEECEKAVN    141 - 210
QSSKLTKHKRIYTCEKLYKCQECDRTFNQFSNLTEYKKDYAREKPYKCEECGKAFNQSSHLTTHKIIHTG    211 - 280
EKPYKCEECGKAFNQFSNLTTHKKIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFN    281 - 350
RSSKLTEHKNIHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTG    351 - 420
EKPYKCEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPYKCEECGKAFK    421 - 490
HSSSLTTHKRIHTGEKPYKCEECGKAFSRSSKLTEHKIIHTGEKPYKCERCDKAFNQSANLTKHKKIHTG    491 - 560
EKLQNWNV                                                                  561 - 568
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11851921 2002 Recognition specificity of self-incompatibility maintained after the divergence of Brassica oleracea and Brassica rapa.
11751921 2002 A novel zinc finger protein that inhibits osteoclastogenesis and the function of tumor necrosis factor receptor-associated factor 6.