Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8TCZ7
Symbols PRED16
C21orf74
NCRNA00308

 Compartment GO Term (0)

AA Sequence

MAYVFNLSCLGSQVERLLEARSSRPTWIIQPSPKKAPEACFSFHSSYERNWA                        1 - 52
//

Text Mined References (1)

PMID Year Title