Property Summary

Ligand Count 6
NCBI Gene PubMed Count 27
PubMed Score 21.97
PubTator Score 23.95

Knowledge Summary

Patent (7,704)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hyperalgesia 83 0.0 0.0
Pain 103 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Ectopic pregnancy 16 3.789 1.9
Orchitis 28 3.636 1.8

Expression

Gene RIF (20)

AA Sequence

METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFAAKIVIGMALV      1 - 70
GIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWEHGHVLCTSV     71 - 140
NYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTATGLIALVWTVSILIAIPSAYFTTETVLVIVK    141 - 210
SQEKIFCGQIWPVDQQLYYKSYFLFIFGIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRR    211 - 280
KTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTV    281 - 350
KYFKKIMLLHWKASYNGGKSSADLDLKTIGMPATEEVDCIRLK                               351 - 393
//

Text Mined References (27)

PMID Year Title