Property Summary

NCBI Gene PubMed Count 27
Grant Count 2
Funding $85,780
PubMed Score 20.48
PubTator Score 23.95

Knowledge Summary

Patent (7,704)

TINX Plot

  Disease Relevance (3)

Disease Z-score Confidence
Ectopic pregnancy 16 3.89 1.9
Hyperalgesia 71
Pain 70

Expression

Synonym

Accession Q8TCW9 A5JUU2 Q53QT9 Q8NFJ7 PK-R1
Symbols ZAQ
PKR1
GPR73
PK-R1
GPR73a

Gene

PANTHER Protein Class (2)

 Grant Application (2)

  TechDev Info (1)

Gene RIF (19)

PMID Text
26574895 Data suggest that prokineticins (PROK1 and PROK2) and prokineticin receptors (PROKR1 and PROKR2) act as main regulators of physiological functions of ovary, uterus, placenta, and testis. [REVIEW]
26475302 EG-VEGF and its receptor PKR1 might play a role in the pathogenesis of adrenocortical tumors and could serve as prognostic markers for this rare malignant disease.
26192875 Expression of PROK1 and PROKR1 was significantly higher in mid-gestation ovaries (17-20 wk) than at earlier gestations (8-11 and 14-16 wk).
25064403 Study corroborates the clinical relevance of the EG-VEGF system in human early pregnancy, and provides evidence for the gene-gene interactions of EG-VEGF and PROKR variants.
23687280 I397V variant confers lower risk for recurrent miscarriage
22138749 hCG increases EG-VEGF, PROKR1 and PROKR2 mRNA and protein expression in a dose- and time-dependent manner, demonstrating a new role for hCG in the regulation of EG-VEGF and its receptors
22132188 The results suggest an identical transmembrane-bundle binding site for hPKR1 and hPKR2.
21876489 The number of PKR1 is not reduced in preeclampsia.
21858136 Findings, together with the detection of sequence variants in PROKR1, PROK1 and PROKR2 genes associated to HSCR and, in some cases in combination with RET or GDNF mutations, provide evidence to consider them as susceptibility genes for HSCR.
20864676 Data suggest that smoking targets human Fallopian tubes via nAChRalpha-7 to increase tubal PROKR1, leading to alterations in the tubal microenvironment that could predispose to ectopic pregnancy.
More...

AA Sequence

METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFAAKIVIGMALV      1 - 70
GIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWEHGHVLCTSV     71 - 140
NYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTATGLIALVWTVSILIAIPSAYFTTETVLVIVK    141 - 210
SQEKIFCGQIWPVDQQLYYKSYFLFIFGIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRR    211 - 280
KTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTV    281 - 350
KYFKKIMLLHWKASYNGGKSSADLDLKTIGMPATEEVDCIRLK                               351 - 393
//

Text Mined References (27)

PMID Year Title
26984842 2016 Association between polymorphisms of prokineticin receptor (PKR1 rs4627609 and PKR2 rs6053283) and recurrent pregnancy loss.
26574895 2015 Prokineticins in central and peripheral control of human reproduction.
26475302 2015 Role of Endocrine Gland-Derived Vascular Endothelial Growth Factor (EG-VEGF) and Its Receptors in Adrenocortical Tumors.
26192875 2015 Prokineticin Ligands and Receptors Are Expressed in the Human Fetal Ovary and Regulate Germ Cell Expression of COX2.
25064403 2014 Gene-gene interactions and risk of recurrent miscarriages in carriers of endocrine gland-derived vascular endothelial growth factor and prokineticin receptor polymorphisms.
23687280 2013 Prokineticin receptor variants (PKR1-I379V and PKR2-V331M) are protective genotypes in human early pregnancy.
22138749 2012 Revisiting the role of hCG: new regulation of the angiogenic factor EG-VEGF and its receptors.
22132188 2011 Modeling of human prokineticin receptors: interactions with novel small-molecule binders and potential off-target drugs.
21876489 2011 The possible role of the PK1 and its receptor in the etiology of the preeclampsia.
21858136 2011 Expression of PROKR1 and PROKR2 in human enteric neural precursor cells and identification of sequence variants suggest a role in HSCR.
More...