Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.82
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQC      1 - 70
VPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARGTAPGCPGQANSDLGSVA     71 - 140
LHLSWGPTERVHDGRPGALPAGQHYLYQRWFQPSDNHWPADTSLQPIHPWFLLLGVKVHSLSSEEGLCIT    141 - 210
PVLCTTAIRASHPS                                                            211 - 224
//

Text Mined References (11)

PMID Year Title