Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.82
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
17511965 C-terminal domain of the nuclear factor I-B2 isoform is glycosylated and transactivates the WAP gene in tumor cells
16462094 analysis of promoter of mutated human whey acidic protein (WAP) gene

AA Sequence

MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQC      1 - 70
VPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARGTAPGCPGQANSDLGSVA     71 - 140
LHLSWGPTERVHDGRPGALPAGQHYLYQRWFQPSDNHWPADTSLQPIHPWFLLLGVKVHSLSSEEGLCIT    141 - 210
PVLCTTAIRASHPS                                                            211 - 224
//

Text Mined References (11)

PMID Year Title
23292442 2013 Reproduction and immunity-driven natural selection in the human WFDC locus.
17511965 2007 The C-terminal domain of the nuclear factor I-B2 isoform is glycosylated and transactivates the WAP gene in the JEG-3 cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16462094 2006 Analysis of the promoter of mutated human whey acidic protein (WAP) gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10680116 1999 The whey acidic protein family: a new signature motif and three-dimensional structure by comparative modeling.
More...