Property Summary

NCBI Gene PubMed Count 23
PubMed Score 24.04
PubTator Score 15.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.413 8.0e-07
adult high grade glioma 1.100 2.9e-03
Amyotrophic lateral sclerosis 1.191 2.7e-03
astrocytic glioma 1.300 4.0e-02
Astrocytoma, Pilocytic 1.200 9.8e-05
atypical teratoid / rhabdoid tumor 1.200 4.0e-04
autosomal dominant Emery-Dreifuss muscul... 1.143 3.3e-02
Breast cancer 3.100 4.8e-02
ependymoma 1.700 3.6e-02
glioblastoma 1.300 2.2e-05
group 3 medulloblastoma 1.100 1.6e-02
juvenile dermatomyositis 1.010 7.7e-08
oligodendroglioma 1.500 3.0e-02
osteosarcoma 1.382 2.1e-02
ovarian cancer -1.300 2.2e-03
pancreatic ductal adenocarcinoma liver m... -2.133 1.3e-02
permanent atrial fibrillation -1.100 8.6e-03
Pick disease 1.700 2.6e-05
primitive neuroectodermal tumor 1.100 5.0e-04
Rheumatoid arthritis 2.500 9.8e-03
ulcerative colitis -1.100 5.1e-06

Gene RIF (7)

AA Sequence

MGPQRRLSPAGAALLWGFLLQLTAAQEAILHASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTST      1 - 70
PLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSGNRSEFPDVKILIAFI     71 - 140
SYKDFRDMNQTLGDNITVKMYSPSWPNFDYTMVVIFVIAVFTVALGGYWSGLVELENLKAVTTEDREMRK    141 - 210
KKEEYLTFSPLTVVIFVVICCVMMVLLYFFYKWLVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIAC    211 - 280
RGKNMEVRLIFLSGLCIAVAVVWAVFRNEDRWAWILQDILGIAFCLNLIKTLKLPNFKSCVILLGLLLLY    281 - 350
DVFFVFITPFITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLI    351 - 420
AYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFW    421 - 490
KGNSYQMMDHLDCATNEENPVISGEQIVQQ                                            491 - 520
//

Text Mined References (25)

PMID Year Title