Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.00
PubTator Score 17.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 4.0e-08
ependymoma 1.300 1.0e-02
glioblastoma 1.600 1.6e-05
group 4 medulloblastoma 1.200 4.0e-03
medulloblastoma, large-cell 1.300 2.9e-04
oligodendroglioma 1.100 4.5e-03
osteosarcoma -1.966 2.8e-05
pediatric high grade glioma 1.100 4.0e-04

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MAAAVAAALARLLAAFLLLAAQVACEYGMVHVVSQAGGPEGKDYCILYNPQWAHLPHDLSKASFLQLRNW      1 - 70
TASLLCSAADLPARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPV     71 - 140
ALLSYKDMLDIFTRFGRTVRAALYAPKEPVLDYNMVIIFIMAVGTVAIGGYWAGSRDVKKRYMKHKRDDG    141 - 210
PEKQEDEAVDVTPVMTCVFVVMCCSMLVLLYYFYDLLVYVVIGIFCLASATGLYSCLAPCVRRLPFGKCR    211 - 280
IPNNSLPYFHKRPQARMLLLALFCVAVSVVWGVFRNEDQWAWVLQDALGIAFCLYMLKTIRLPTFKACTL    281 - 350
LLLVLFLYDIFFVFITPFLTKSGSSIMVEVATGPSDSATREKLPMVLKVPRLNSSPLALCDRPFSLLGFG    351 - 420
DILVPGLLVAYCHRFDIQVQSSRVYFVACTIAYGVGLLVTFVALALMQRGQPALLYLVPCTLVTSCAVAL    421 - 490
WRRELGVFWTGSGFAKVLPPSPWAPAPADGPQPPKDSATPLSPQPPSEEPATSPWPAEQSPKSRTSEEMG    491 - 560
AGAPMREPGSPAESEGRDQAQPSPVTQPGASA                                          561 - 592
//

Text Mined References (21)

PMID Year Title