Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.00
PubTator Score 17.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma 1.600 0.008
oligodendroglioma 1.100 0.004
osteosarcoma -1.966 0.000
atypical teratoid / rhabdoid tumor 1.800 0.000
glioblastoma 1.600 0.000
medulloblastoma 1.200 0.001
medulloblastoma, large-cell 1.300 0.000
pediatric high grade glioma 1.100 0.000

Synonym

Accession Q8TCT7 D6W609 O60365 Q567S3 Q8IUH9 Q9BUY6 Q9H3M4 Q9NPN2 Q9P1Z6 SPP-like 2B
Symbols IMP4
PSH4
PSL1
IMP-4

Gene

PANTHER Protein Class (3)

Gene RIF (7)

PMID Text
23384347 TfR1 N-terminal fragment is a substrate for intramembrane proteolysis by SPPL2b.
22194595 The alpha-helical content of the transmembrane domain of the British dementia protein-2 (Bri2) determines its processing by signal peptide peptidase-like 2b (SPPL2b).
18768471 Alzheimer disease-like mutant SPPL2b slowed intramembrane proteolysis of tumor necrosis factor alpha and caused a relative increase of longer intracellular cleavage products.
17965014 SPPL2a and SPPL2b mediate the intramembrane cleavage, whereas neither SPP nor SPPL3 is capable of processing the Bri2 N-terminal fragment.
16829951 Results demonstrate that SPPL2b utilizes multiple intramembrane cleavages to liberate the intracellular domain of tumor necrosis factor alpha into the cytosol.
15998642 SPPL2b is targeted through the secretory pathway to endosomes/lysosomes, whereas SPP and SPPL3 are restricted to the ER.
15385547 SPP, SPPL2a, -2b, -2c, and -3 probably cleave type II-oriented substrate peptides as shown by consensus analysis

AA Sequence

MAAAVAAALARLLAAFLLLAAQVACEYGMVHVVSQAGGPEGKDYCILYNPQWAHLPHDLSKASFLQLRNW      1 - 70
TASLLCSAADLPARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPV     71 - 140
ALLSYKDMLDIFTRFGRTVRAALYAPKEPVLDYNMVIIFIMAVGTVAIGGYWAGSRDVKKRYMKHKRDDG    141 - 210
PEKQEDEAVDVTPVMTCVFVVMCCSMLVLLYYFYDLLVYVVIGIFCLASATGLYSCLAPCVRRLPFGKCR    211 - 280
IPNNSLPYFHKRPQARMLLLALFCVAVSVVWGVFRNEDQWAWVLQDALGIAFCLYMLKTIRLPTFKACTL    281 - 350
LLLVLFLYDIFFVFITPFLTKSGSSIMVEVATGPSDSATREKLPMVLKVPRLNSSPLALCDRPFSLLGFG    351 - 420
DILVPGLLVAYCHRFDIQVQSSRVYFVACTIAYGVGLLVTFVALALMQRGQPALLYLVPCTLVTSCAVAL    421 - 490
WRRELGVFWTGSGFAKVLPPSPWAPAPADGPQPPKDSATPLSPQPPSEEPATSPWPAEQSPKSRTSEEMG    491 - 560
AGAPMREPGSPAESEGRDQAQPSPVTQPGASA                                          561 - 592
//

Text Mined References (21)

PMID Year Title
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
23384347 2013 The transferrin receptor-1 membrane stub undergoes intramembrane proteolysis by signal peptide peptidase-like 2b.
23132852 2012 Foamy virus envelope protein is a substrate for signal peptide peptidase-like 3 (SPPL3).
22194595 2012 The ?-helical content of the transmembrane domain of the British dementia protein-2 (Bri2) determines its processing by signal peptide peptidase-like 2b (SPPL2b).
21896273 2011 Signal-peptide-peptidase-like 2a (SPPL2a) is targeted to lysosomes/late endosomes by a tyrosine motif in its C-terminal tail.
19114711 2009 Substrate requirements for SPPL2b-dependent regulated intramembrane proteolysis.
18768471 2008 Intramembrane proteolysis of GXGD-type aspartyl proteases is slowed by a familial Alzheimer disease-like mutation.
17965014 2008 Regulated intramembrane proteolysis of Bri2 (Itm2b) by ADAM10 and SPPL2a/SPPL2b.
16873890 2006 Intramembrane proteolytic cleavage by human signal peptide peptidase like 3 and malaria signal peptide peptidase.
16829952 2006 SPPL2a and SPPL2b promote intramembrane proteolysis of TNFalpha in activated dendritic cells to trigger IL-12 production.
More...